FuNGI

G2RF96

Protein Details

Accession

G2RF96

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
414-462	EFEVRREPKQKAQQQKQQQKQQNGDGGDQQQPSKKRKREEPEDSERERE	Hydrophilic

NLS Segment(s)

Position	Sequence
447-453	KKRKREE

Subcellular Location(s)

cyto 11, nucl 5, cysk 5, mito 4

Family & Domain DBs

InterPro	View protein in InterPro IPR013785 Aldolase_TIM IPR035587 DUS-like_FMN-bd IPR018517 tRNA_hU_synthase_CS
Gene Ontology	GO:0050660 F:flavin adenine dinucleotide binding GO:0102265 F:tRNA-dihydrouridine47 synthase activity GO:0006397 P:mRNA processing
KEGG	ttt:THITE_2121762 -
Pfam	View protein in Pfam PF01207 Dus
PROSITE	View protein in PROSITE PS01136 UPF0034
CDD	cd02801 DUS_like_FMN

Amino Acid Sequences

MATAEETAAAVMTATTTATATATAASTVTPSTPTPAPTPAAATATDDAPTPAAPPRVPIPPRGVDYRGKLVLAPMVRSGELPSRLLALHYGADLVWGPETVDHSLIGASRRINPRTGMVEYTRQPSHSYSASAGPDHDPSAPLESVIYRLDPVREAGKLIFQLGTSDPARAVAAARLVAPDVAGIDVNAGCPKPFSVSGGMGAALLRTPDKLAAILAALAREIPRDFGIAVSVKIRLLETAAETEALVRRLVATGIAGLTVHCRTPPMRPREPAIRGQLRMVARLCREAGVACLMNGDVEGRDQAAALVREFGVDGAMIATAAERNPSCFRAAADGGLAPWPEAVERYLRLAMEVENKIANTKFLLTQMIPGKAPVYREVHRCKSYTDLVRALGHADQLGAMARETDRVLGLGEFEVRREPKQKAQQQKQQQKQQNGDGGDQQQPSKKRKREEPEDSERERERERERERENAANEAGKQVTELAEPAPAVAPATVAV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.04
2	0.05
3	0.05
4	0.05
5	0.06
6	0.06
7	0.06
8	0.07
9	0.07
10	0.07
11	0.07
12	0.07
13	0.08
14	0.08
15	0.08
16	0.1
17	0.1
18	0.14
19	0.16
20	0.19
21	0.21
22	0.24
23	0.26
24	0.24
25	0.28
26	0.25
27	0.25
28	0.22
29	0.23
30	0.2
31	0.19
32	0.18
33	0.15
34	0.14
35	0.13
36	0.12
37	0.11
38	0.14
39	0.17
40	0.16
41	0.19
42	0.22
43	0.31
44	0.32
45	0.36
46	0.38
47	0.4
48	0.44
49	0.47
50	0.47
51	0.44
52	0.48
53	0.5
54	0.45
55	0.39
56	0.35
57	0.31
58	0.32
59	0.28
60	0.24
61	0.19
62	0.19
63	0.19
64	0.19
65	0.21
66	0.22
67	0.22
68	0.22
69	0.2
70	0.2
71	0.19
72	0.19
73	0.18
74	0.13
75	0.11
76	0.1
77	0.1
78	0.08
79	0.09
80	0.08
81	0.08
82	0.07
83	0.06
84	0.06
85	0.07
86	0.09
87	0.1
88	0.1
89	0.09
90	0.09
91	0.1
92	0.11
93	0.12
94	0.13
95	0.13
96	0.2
97	0.27
98	0.29
99	0.31
100	0.31
101	0.33
102	0.36
103	0.36
104	0.33
105	0.29
106	0.34
107	0.34
108	0.38
109	0.35
110	0.31
111	0.3
112	0.29
113	0.29
114	0.24
115	0.23
116	0.2
117	0.24
118	0.25
119	0.23
120	0.22
121	0.2
122	0.2
123	0.19
124	0.18
125	0.13
126	0.13
127	0.17
128	0.15
129	0.13
130	0.12
131	0.11
132	0.13
133	0.12
134	0.12
135	0.08
136	0.09
137	0.1
138	0.1
139	0.12
140	0.12
141	0.12
142	0.13
143	0.12
144	0.14
145	0.14
146	0.14
147	0.13
148	0.1
149	0.12
150	0.11
151	0.15
152	0.13
153	0.13
154	0.12
155	0.12
156	0.12
157	0.1
158	0.1
159	0.07
160	0.08
161	0.08
162	0.08
163	0.08
164	0.08
165	0.07
166	0.06
167	0.05
168	0.04
169	0.04
170	0.04
171	0.03
172	0.04
173	0.04
174	0.05
175	0.06
176	0.06
177	0.05
178	0.06
179	0.06
180	0.08
181	0.08
182	0.1
183	0.11
184	0.12
185	0.13
186	0.13
187	0.13
188	0.11
189	0.1
190	0.08
191	0.05
192	0.05
193	0.04
194	0.04
195	0.04
196	0.05
197	0.05
198	0.05
199	0.05
200	0.05
201	0.05
202	0.06
203	0.06
204	0.05
205	0.05
206	0.05
207	0.05
208	0.05
209	0.05
210	0.06
211	0.06
212	0.06
213	0.06
214	0.06
215	0.08
216	0.08
217	0.08
218	0.08
219	0.09
220	0.08
221	0.08
222	0.08
223	0.06
224	0.06
225	0.06
226	0.06
227	0.07
228	0.07
229	0.07
230	0.06
231	0.07
232	0.08
233	0.08
234	0.07
235	0.06
236	0.06
237	0.06
238	0.06
239	0.06
240	0.04
241	0.04
242	0.04
243	0.04
244	0.04
245	0.03
246	0.05
247	0.06
248	0.06
249	0.05
250	0.07
251	0.08
252	0.16
253	0.24
254	0.31
255	0.37
256	0.39
257	0.43
258	0.5
259	0.54
260	0.51
261	0.52
262	0.49
263	0.43
264	0.42
265	0.43
266	0.35
267	0.34
268	0.3
269	0.25
270	0.2
271	0.22
272	0.21
273	0.16
274	0.16
275	0.13
276	0.13
277	0.12
278	0.11
279	0.08
280	0.08
281	0.08
282	0.07
283	0.07
284	0.06
285	0.04
286	0.04
287	0.04
288	0.04
289	0.04
290	0.04
291	0.05
292	0.07
293	0.08
294	0.08
295	0.09
296	0.08
297	0.08
298	0.08
299	0.08
300	0.05
301	0.04
302	0.04
303	0.03
304	0.03
305	0.03
306	0.03
307	0.03
308	0.03
309	0.04
310	0.06
311	0.06
312	0.09
313	0.12
314	0.13
315	0.14
316	0.15
317	0.15
318	0.18
319	0.19
320	0.16
321	0.15
322	0.13
323	0.12
324	0.13
325	0.12
326	0.07
327	0.07
328	0.06
329	0.06
330	0.06
331	0.07
332	0.08
333	0.09
334	0.12
335	0.13
336	0.13
337	0.13
338	0.13
339	0.15
340	0.19
341	0.2
342	0.18
343	0.17
344	0.18
345	0.19
346	0.18
347	0.17
348	0.11
349	0.12
350	0.12
351	0.12
352	0.15
353	0.13
354	0.2
355	0.24
356	0.25
357	0.23
358	0.22
359	0.22
360	0.2
361	0.22
362	0.21
363	0.22
364	0.25
365	0.33
366	0.42
367	0.49
368	0.51
369	0.51
370	0.47
371	0.48
372	0.51
373	0.5
374	0.47
375	0.42
376	0.41
377	0.41
378	0.39
379	0.35
380	0.27
381	0.2
382	0.15
383	0.12
384	0.09
385	0.08
386	0.09
387	0.07
388	0.06
389	0.07
390	0.07
391	0.09
392	0.09
393	0.1
394	0.09
395	0.09
396	0.1
397	0.08
398	0.09
399	0.09
400	0.12
401	0.11
402	0.12
403	0.18
404	0.19
405	0.24
406	0.28
407	0.32
408	0.38
409	0.48
410	0.57
411	0.62
412	0.7
413	0.76
414	0.82
415	0.89
416	0.89
417	0.89
418	0.89
419	0.87
420	0.83
421	0.81
422	0.77
423	0.69
424	0.61
425	0.57
426	0.52
427	0.48
428	0.43
429	0.39
430	0.38
431	0.43
432	0.5
433	0.54
434	0.58
435	0.61
436	0.69
437	0.77
438	0.81
439	0.85
440	0.85
441	0.86
442	0.87
443	0.83
444	0.8
445	0.73
446	0.67
447	0.6
448	0.58
449	0.55
450	0.56
451	0.59
452	0.62
453	0.62
454	0.66
455	0.68
456	0.69
457	0.64
458	0.59
459	0.54
460	0.48
461	0.44
462	0.39
463	0.34
464	0.25
465	0.23
466	0.19
467	0.17
468	0.14
469	0.14
470	0.11
471	0.12
472	0.12
473	0.12
474	0.12
475	0.1
476	0.1
477	0.09

G2RF96

3D AlphaFold-predicted Structure Viewer