Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2QUL8

Protein Details
Accession G2QUL8    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-63QPSVRSRKSRWYAKRPPATMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, mito 8, cyto 4.5
Family & Domain DBs
KEGG ttt:THITE_2110853  -  
Amino Acid Sequences MAWARNRFLRDASYASGEGRLFDQRELSASGREPGSLEAVSRYQPSVRSRKSRWYAKRPPATMAGELSAPSPPVNITPSASPVPIHVADR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.27
4 0.23
5 0.2
6 0.18
7 0.19
8 0.16
9 0.16
10 0.17
11 0.14
12 0.16
13 0.18
14 0.18
15 0.15
16 0.15
17 0.17
18 0.16
19 0.15
20 0.14
21 0.12
22 0.13
23 0.1
24 0.1
25 0.09
26 0.1
27 0.1
28 0.1
29 0.1
30 0.09
31 0.14
32 0.19
33 0.26
34 0.32
35 0.38
36 0.41
37 0.5
38 0.58
39 0.64
40 0.68
41 0.7
42 0.74
43 0.77
44 0.83
45 0.75
46 0.7
47 0.66
48 0.59
49 0.5
50 0.4
51 0.31
52 0.23
53 0.21
54 0.18
55 0.13
56 0.1
57 0.08
58 0.08
59 0.07
60 0.09
61 0.11
62 0.12
63 0.13
64 0.14
65 0.19
66 0.2
67 0.2
68 0.19
69 0.18
70 0.22