Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2RGH5

Protein Details
Accession G2RGH5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-67QLRFEKKYKRRLKLASARPRWDKFHydrophilic
NLS Segment(s)
PositionSequence
49-59KKYKRRLKLAS
Subcellular Location(s) mito 18.5, cyto_mito 10.5, nucl 6
Family & Domain DBs
KEGG ttt:THITE_18100  -  
Amino Acid Sequences MLPTLVRRLAQAAKPQLNEAAVNYKYKLKKVWPPDMGTMSPQQQLRFEKKYKRRLKLASARPRWDKFVRLAQLFTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.43
4 0.38
5 0.33
6 0.26
7 0.24
8 0.2
9 0.21
10 0.21
11 0.26
12 0.26
13 0.28
14 0.3
15 0.29
16 0.35
17 0.42
18 0.51
19 0.48
20 0.5
21 0.51
22 0.51
23 0.45
24 0.39
25 0.33
26 0.25
27 0.24
28 0.22
29 0.19
30 0.2
31 0.25
32 0.29
33 0.34
34 0.39
35 0.45
36 0.53
37 0.64
38 0.69
39 0.72
40 0.75
41 0.75
42 0.8
43 0.8
44 0.81
45 0.82
46 0.81
47 0.81
48 0.8
49 0.77
50 0.73
51 0.67
52 0.61
53 0.57
54 0.58
55 0.58
56 0.52