Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R8J8

Protein Details
Accession G2R8J8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-25LAKHIPGRSNKDCRKRWWNSLVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
IPR017884  SANT_dom  
KEGG ttt:THITE_2027678  -  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
PS51293  SANT  
CDD cd00167  SANT  
Amino Acid Sequences WRELAKHIPGRSNKDCRKRWWNSLVGGTAKGAWSPEEDRKLVEAVGKYGTNWSRVAAAVGTRSGDQCSSHWRQVLNPNINYCDWTKEEDDRLLEAVRICGTNWSNIASFHVPQRTTLALKNRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.78
4 0.81
5 0.8
6 0.81
7 0.78
8 0.75
9 0.69
10 0.67
11 0.63
12 0.54
13 0.46
14 0.37
15 0.29
16 0.23
17 0.18
18 0.13
19 0.09
20 0.11
21 0.14
22 0.2
23 0.23
24 0.23
25 0.24
26 0.25
27 0.25
28 0.22
29 0.21
30 0.15
31 0.13
32 0.14
33 0.14
34 0.12
35 0.17
36 0.17
37 0.16
38 0.16
39 0.15
40 0.14
41 0.14
42 0.14
43 0.09
44 0.09
45 0.07
46 0.07
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.08
53 0.08
54 0.15
55 0.19
56 0.21
57 0.23
58 0.23
59 0.26
60 0.33
61 0.42
62 0.42
63 0.39
64 0.39
65 0.39
66 0.39
67 0.37
68 0.3
69 0.24
70 0.18
71 0.19
72 0.2
73 0.21
74 0.24
75 0.25
76 0.25
77 0.22
78 0.23
79 0.2
80 0.19
81 0.16
82 0.14
83 0.13
84 0.12
85 0.11
86 0.16
87 0.16
88 0.17
89 0.18
90 0.19
91 0.19
92 0.19
93 0.24
94 0.21
95 0.21
96 0.25
97 0.3
98 0.28
99 0.29
100 0.32
101 0.31
102 0.31
103 0.36