Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q0US36

Protein Details
Accession Q0US36    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTTTRPTSRRSRTAPKGPDRGIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
KEGG pno:SNOG_05428  -  
Amino Acid Sequences MTTTRPTSRRSRTAPKGPDRGIAGRLAQRAGEEVDQEVQDRGRGELEQSSLDFCGVSSRLGQDEVASLQVQLLQRLRATHLQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.82
4 0.75
5 0.71
6 0.65
7 0.57
8 0.49
9 0.4
10 0.34
11 0.29
12 0.28
13 0.24
14 0.19
15 0.17
16 0.16
17 0.15
18 0.13
19 0.09
20 0.09
21 0.1
22 0.1
23 0.1
24 0.09
25 0.08
26 0.09
27 0.09
28 0.08
29 0.08
30 0.07
31 0.08
32 0.09
33 0.1
34 0.09
35 0.09
36 0.1
37 0.09
38 0.09
39 0.08
40 0.06
41 0.08
42 0.08
43 0.08
44 0.08
45 0.09
46 0.1
47 0.11
48 0.11
49 0.09
50 0.1
51 0.1
52 0.11
53 0.1
54 0.09
55 0.08
56 0.12
57 0.12
58 0.15
59 0.16
60 0.17
61 0.18
62 0.2
63 0.25