Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R7C0

Protein Details
Accession G2R7C0    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
92-119RSAIKKRCEHCKVVRRKANKRHNGYLYVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ttt:THITE_2116938  -  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASLSVLSQTARSAASATRSLTSSMRALSLSSAAAARPAMQTQTRSLSQAVLSTPRAPTTLGTRAATSATAPAVQSGVAVFQRQQVRGMKVRSAIKKRCEHCKVVRRKANKRHNGYLYVICPANPRHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.15
3 0.18
4 0.19
5 0.19
6 0.2
7 0.22
8 0.21
9 0.22
10 0.19
11 0.17
12 0.16
13 0.15
14 0.14
15 0.13
16 0.13
17 0.1
18 0.09
19 0.08
20 0.07
21 0.08
22 0.07
23 0.08
24 0.08
25 0.08
26 0.1
27 0.12
28 0.14
29 0.16
30 0.2
31 0.2
32 0.2
33 0.2
34 0.19
35 0.17
36 0.17
37 0.15
38 0.14
39 0.14
40 0.14
41 0.14
42 0.13
43 0.14
44 0.12
45 0.12
46 0.14
47 0.18
48 0.19
49 0.19
50 0.19
51 0.19
52 0.19
53 0.18
54 0.13
55 0.08
56 0.06
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.05
63 0.04
64 0.05
65 0.05
66 0.06
67 0.06
68 0.11
69 0.15
70 0.15
71 0.2
72 0.23
73 0.27
74 0.33
75 0.35
76 0.32
77 0.35
78 0.42
79 0.47
80 0.52
81 0.55
82 0.58
83 0.64
84 0.66
85 0.71
86 0.69
87 0.68
88 0.69
89 0.72
90 0.74
91 0.77
92 0.81
93 0.8
94 0.85
95 0.88
96 0.88
97 0.89
98 0.86
99 0.85
100 0.83
101 0.78
102 0.72
103 0.67
104 0.58
105 0.52
106 0.44
107 0.34
108 0.33
109 0.33
110 0.38
111 0.41
112 0.47