Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2R2N2

Protein Details
Accession G2R2N2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
55-76LSERGHFRRRHVRARLKRMICRBasic
NLS Segment(s)
PositionSequence
62-71RRRHVRARLK
Subcellular Location(s) nucl 10.5, cyto_nucl 10, cyto 8.5, mito 4, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000048  IQ_motif_EF-hand-BS  
Gene Ontology GO:0015629  C:actin cytoskeleton  
GO:0006996  P:organelle organization  
KEGG ttt:THITE_2115025  -  
PROSITE View protein in PROSITE  
PS50096  IQ  
Amino Acid Sequences MCELERPGQMAERNPPDAQRWLQPASGIFQIPGDVHVYRFVESFQEHGSRLRLQLSERGHFRRRHVRARLKRMICR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.37
4 0.39
5 0.37
6 0.34
7 0.33
8 0.31
9 0.31
10 0.3
11 0.27
12 0.24
13 0.24
14 0.18
15 0.13
16 0.11
17 0.11
18 0.1
19 0.1
20 0.09
21 0.08
22 0.08
23 0.1
24 0.11
25 0.1
26 0.11
27 0.1
28 0.09
29 0.1
30 0.11
31 0.1
32 0.11
33 0.12
34 0.13
35 0.16
36 0.15
37 0.16
38 0.18
39 0.17
40 0.17
41 0.23
42 0.27
43 0.3
44 0.35
45 0.41
46 0.46
47 0.49
48 0.55
49 0.59
50 0.63
51 0.67
52 0.72
53 0.76
54 0.8
55 0.86
56 0.89