Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2RGG7

Protein Details
Accession G2RGG7   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
4-24SEPSARRRKPDPKTTTTPPPSHydrophilic
NLS Segment(s)
PositionSequence
33-38KARPKK
Subcellular Location(s) nucl 10.5, cyto_nucl 8.5, cyto 5.5, plas 4, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG ttt:THITE_2124716  -  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
Amino Acid Sequences MADSEPSARRRKPDPKTTTTPPPSEPEPAEAEKARPKKKTAQDLLDDDEAYSSPYIDILRVLTFLFLASCGLSYLISGGETFFWGMSNPPKYLQSSWWKKQFRGPIYLTPAELAAYDGSDPSKPLYLAINWTIYDVSANRRTYGPGGSYHYFAGCDAARAYITGCFAEDRTPDLRGVEEMFLPLDDPAVDARYWTPAELERLRAQERREAERRAHDALAHWVKFFRDHPKYQFVGYVKRPEGWPGTEPRRPLCEHAAKARKPRTPPGQEQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.79
4 0.81
5 0.82
6 0.8
7 0.74
8 0.66
9 0.62
10 0.57
11 0.55
12 0.49
13 0.41
14 0.4
15 0.37
16 0.39
17 0.35
18 0.36
19 0.39
20 0.46
21 0.5
22 0.49
23 0.52
24 0.57
25 0.65
26 0.71
27 0.71
28 0.7
29 0.7
30 0.69
31 0.69
32 0.61
33 0.52
34 0.4
35 0.32
36 0.24
37 0.18
38 0.14
39 0.09
40 0.07
41 0.08
42 0.08
43 0.07
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.08
50 0.07
51 0.07
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.07
73 0.13
74 0.15
75 0.16
76 0.17
77 0.19
78 0.22
79 0.23
80 0.28
81 0.33
82 0.4
83 0.46
84 0.54
85 0.55
86 0.54
87 0.59
88 0.61
89 0.55
90 0.53
91 0.49
92 0.46
93 0.49
94 0.49
95 0.42
96 0.33
97 0.29
98 0.21
99 0.18
100 0.12
101 0.06
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.06
109 0.07
110 0.06
111 0.07
112 0.09
113 0.08
114 0.11
115 0.12
116 0.13
117 0.12
118 0.12
119 0.11
120 0.1
121 0.1
122 0.08
123 0.11
124 0.16
125 0.16
126 0.17
127 0.17
128 0.19
129 0.19
130 0.2
131 0.17
132 0.13
133 0.18
134 0.18
135 0.19
136 0.18
137 0.17
138 0.16
139 0.14
140 0.14
141 0.08
142 0.08
143 0.07
144 0.07
145 0.07
146 0.07
147 0.08
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.07
154 0.09
155 0.09
156 0.11
157 0.12
158 0.14
159 0.14
160 0.13
161 0.14
162 0.12
163 0.14
164 0.11
165 0.1
166 0.09
167 0.09
168 0.08
169 0.08
170 0.07
171 0.05
172 0.04
173 0.05
174 0.05
175 0.07
176 0.06
177 0.07
178 0.07
179 0.11
180 0.11
181 0.11
182 0.11
183 0.12
184 0.19
185 0.2
186 0.24
187 0.25
188 0.29
189 0.32
190 0.34
191 0.34
192 0.34
193 0.37
194 0.41
195 0.44
196 0.44
197 0.45
198 0.5
199 0.53
200 0.51
201 0.47
202 0.39
203 0.35
204 0.41
205 0.44
206 0.36
207 0.32
208 0.29
209 0.29
210 0.31
211 0.33
212 0.34
213 0.33
214 0.4
215 0.45
216 0.52
217 0.53
218 0.51
219 0.53
220 0.46
221 0.48
222 0.47
223 0.5
224 0.44
225 0.45
226 0.45
227 0.43
228 0.44
229 0.39
230 0.38
231 0.38
232 0.44
233 0.46
234 0.48
235 0.48
236 0.5
237 0.49
238 0.49
239 0.5
240 0.51
241 0.53
242 0.6
243 0.66
244 0.66
245 0.74
246 0.77
247 0.74
248 0.71
249 0.76
250 0.76
251 0.76