Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2RB50

Protein Details
Accession G2RB50   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
226-247AGSGGKTKRERERKTKQFVELDHydrophilic
NLS Segment(s)
PositionSequence
76-111AGRESNRGKPTDEAPRGGRRGGFRGRGGRREEGGDR
233-239KRERERK
255-290RTRGGRGGRGGARGDAGRGRGRGGPRGEFRGGRGRG
Subcellular Location(s) cyto_nucl 10.5, cyto 10, mito 8, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039764  HABP4/SERBP1  
IPR006861  HABP4_PAIRBP1-bd  
IPR019084  Stm1-like_N  
Gene Ontology GO:0003723  F:RNA binding  
KEGG ttt:THITE_2118995  -  
Pfam View protein in Pfam  
PF09598  Stm1_N  
Amino Acid Sequences MAVPTKNTFAIFAELGNDEGDEIPTIPVKAVEKTSTHTAKRNTDGLAPTKAPASGGNRRGGAAVGGNEAAFRDRNAGRESNRGKPTDEAPRGGRRGGFRGRGGRREEGGDRHPTRSAPHNSEKQAAQSWGANEGKAELKDEQAAEEIAQTEQKEGEAAPEAEAKEEEPQEKHLTYDQYLAQLAEKKLALEAEAALKVRKPNEGVKDDKWKDFAPLTKKDDEEELFAGSGGKTKRERERKTKQFVELDNRYIEPERTRGGRGGRGGARGDAGRGRGRGGPRGEFRGGRGRGGENQPPLNTNDQDAFPSLGSAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.15
4 0.13
5 0.1
6 0.1
7 0.1
8 0.08
9 0.08
10 0.09
11 0.1
12 0.1
13 0.1
14 0.12
15 0.14
16 0.16
17 0.19
18 0.21
19 0.21
20 0.26
21 0.35
22 0.4
23 0.41
24 0.46
25 0.5
26 0.53
27 0.57
28 0.56
29 0.49
30 0.47
31 0.48
32 0.45
33 0.44
34 0.37
35 0.33
36 0.3
37 0.28
38 0.23
39 0.23
40 0.25
41 0.29
42 0.33
43 0.37
44 0.36
45 0.37
46 0.36
47 0.32
48 0.26
49 0.19
50 0.15
51 0.12
52 0.11
53 0.11
54 0.1
55 0.1
56 0.11
57 0.09
58 0.08
59 0.12
60 0.13
61 0.17
62 0.21
63 0.26
64 0.27
65 0.37
66 0.41
67 0.45
68 0.49
69 0.47
70 0.45
71 0.42
72 0.45
73 0.46
74 0.45
75 0.39
76 0.39
77 0.45
78 0.45
79 0.44
80 0.42
81 0.34
82 0.37
83 0.4
84 0.4
85 0.37
86 0.45
87 0.49
88 0.52
89 0.54
90 0.5
91 0.45
92 0.44
93 0.43
94 0.38
95 0.37
96 0.4
97 0.37
98 0.36
99 0.36
100 0.32
101 0.32
102 0.36
103 0.39
104 0.36
105 0.41
106 0.46
107 0.47
108 0.5
109 0.48
110 0.41
111 0.37
112 0.31
113 0.25
114 0.2
115 0.18
116 0.2
117 0.2
118 0.17
119 0.14
120 0.15
121 0.16
122 0.14
123 0.15
124 0.1
125 0.1
126 0.12
127 0.12
128 0.11
129 0.09
130 0.09
131 0.07
132 0.07
133 0.07
134 0.06
135 0.07
136 0.07
137 0.07
138 0.06
139 0.06
140 0.06
141 0.05
142 0.06
143 0.07
144 0.07
145 0.07
146 0.09
147 0.09
148 0.1
149 0.1
150 0.09
151 0.1
152 0.11
153 0.12
154 0.1
155 0.13
156 0.16
157 0.16
158 0.17
159 0.17
160 0.18
161 0.17
162 0.19
163 0.17
164 0.15
165 0.16
166 0.15
167 0.13
168 0.16
169 0.16
170 0.15
171 0.14
172 0.13
173 0.13
174 0.13
175 0.12
176 0.07
177 0.08
178 0.08
179 0.09
180 0.09
181 0.09
182 0.11
183 0.13
184 0.13
185 0.15
186 0.16
187 0.22
188 0.29
189 0.34
190 0.38
191 0.4
192 0.5
193 0.51
194 0.5
195 0.46
196 0.39
197 0.37
198 0.35
199 0.36
200 0.33
201 0.38
202 0.41
203 0.42
204 0.42
205 0.4
206 0.41
207 0.35
208 0.31
209 0.24
210 0.2
211 0.16
212 0.15
213 0.15
214 0.11
215 0.14
216 0.12
217 0.16
218 0.19
219 0.25
220 0.35
221 0.46
222 0.55
223 0.61
224 0.72
225 0.77
226 0.83
227 0.84
228 0.81
229 0.78
230 0.76
231 0.75
232 0.69
233 0.62
234 0.54
235 0.48
236 0.43
237 0.37
238 0.33
239 0.26
240 0.24
241 0.25
242 0.25
243 0.27
244 0.29
245 0.31
246 0.34
247 0.34
248 0.39
249 0.38
250 0.39
251 0.38
252 0.34
253 0.32
254 0.27
255 0.27
256 0.22
257 0.22
258 0.23
259 0.22
260 0.24
261 0.27
262 0.3
263 0.35
264 0.37
265 0.41
266 0.41
267 0.47
268 0.5
269 0.46
270 0.47
271 0.5
272 0.46
273 0.41
274 0.39
275 0.37
276 0.4
277 0.46
278 0.49
279 0.45
280 0.48
281 0.47
282 0.46
283 0.45
284 0.44
285 0.38
286 0.34
287 0.31
288 0.27
289 0.28
290 0.27
291 0.26
292 0.19
293 0.2