Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2RDS6

Protein Details
Accession G2RDS6    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
23-46AQTRISRTSQPQPRRSKPERVAAGHydrophilic
122-149PEGYVFKTKKTTKRRNRTKKTTETPIPEHydrophilic
NLS Segment(s)
PositionSequence
130-140KKTTKRRNRTK
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
KEGG ttt:THITE_2120812  -  
Amino Acid Sequences MARRKSKGAEARNADNADSTSAAQTRISRTSQPQPRRSKPERVAAGKSAGKVQQCHQVRPKITPVPASAVSCPKTAVKTEQLSVRIRSQAQTSQKKRPTAMAGHKQGANPASNGVRAQLEVPEGYVFKTKKTTKRRNRTKKTTETPIPEPEPVRPWEIDREYPKPQDDTKSFNYERNKWRSFGNKDAKKEIEKALARGSRARLPQIFPDSTPEQLERAQRIYWSKNERKLYHIRLTKRAEPILSRLFIVRTTTIGWSSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.48
3 0.4
4 0.32
5 0.26
6 0.21
7 0.17
8 0.16
9 0.17
10 0.17
11 0.19
12 0.22
13 0.25
14 0.27
15 0.29
16 0.35
17 0.44
18 0.52
19 0.6
20 0.65
21 0.71
22 0.77
23 0.83
24 0.83
25 0.83
26 0.8
27 0.8
28 0.8
29 0.76
30 0.72
31 0.65
32 0.65
33 0.57
34 0.5
35 0.45
36 0.39
37 0.35
38 0.32
39 0.31
40 0.34
41 0.35
42 0.42
43 0.45
44 0.5
45 0.49
46 0.51
47 0.56
48 0.53
49 0.52
50 0.49
51 0.43
52 0.4
53 0.4
54 0.37
55 0.32
56 0.32
57 0.31
58 0.27
59 0.27
60 0.23
61 0.22
62 0.22
63 0.24
64 0.25
65 0.26
66 0.28
67 0.32
68 0.35
69 0.36
70 0.37
71 0.35
72 0.32
73 0.3
74 0.29
75 0.27
76 0.29
77 0.36
78 0.44
79 0.46
80 0.53
81 0.58
82 0.6
83 0.58
84 0.56
85 0.51
86 0.49
87 0.53
88 0.53
89 0.52
90 0.51
91 0.52
92 0.47
93 0.44
94 0.38
95 0.29
96 0.19
97 0.16
98 0.14
99 0.13
100 0.13
101 0.12
102 0.1
103 0.09
104 0.09
105 0.08
106 0.08
107 0.07
108 0.07
109 0.07
110 0.07
111 0.07
112 0.12
113 0.11
114 0.11
115 0.19
116 0.24
117 0.33
118 0.44
119 0.54
120 0.6
121 0.71
122 0.82
123 0.86
124 0.91
125 0.93
126 0.92
127 0.91
128 0.87
129 0.85
130 0.8
131 0.75
132 0.68
133 0.63
134 0.55
135 0.48
136 0.42
137 0.34
138 0.31
139 0.27
140 0.25
141 0.2
142 0.2
143 0.24
144 0.26
145 0.3
146 0.31
147 0.35
148 0.37
149 0.4
150 0.4
151 0.36
152 0.36
153 0.37
154 0.35
155 0.37
156 0.36
157 0.42
158 0.42
159 0.44
160 0.49
161 0.49
162 0.56
163 0.59
164 0.56
165 0.49
166 0.53
167 0.57
168 0.56
169 0.59
170 0.6
171 0.58
172 0.6
173 0.65
174 0.64
175 0.58
176 0.55
177 0.48
178 0.47
179 0.41
180 0.39
181 0.41
182 0.4
183 0.38
184 0.39
185 0.38
186 0.35
187 0.36
188 0.4
189 0.35
190 0.35
191 0.41
192 0.43
193 0.41
194 0.35
195 0.39
196 0.36
197 0.34
198 0.34
199 0.28
200 0.23
201 0.25
202 0.3
203 0.27
204 0.28
205 0.27
206 0.28
207 0.33
208 0.36
209 0.41
210 0.46
211 0.51
212 0.57
213 0.66
214 0.64
215 0.65
216 0.7
217 0.7
218 0.69
219 0.69
220 0.67
221 0.67
222 0.73
223 0.72
224 0.69
225 0.65
226 0.59
227 0.54
228 0.55
229 0.53
230 0.47
231 0.4
232 0.35
233 0.32
234 0.3
235 0.3
236 0.24
237 0.19
238 0.2
239 0.21