Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2RBS0

Protein Details
Accession G2RBS0    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
23-64VLRVVGPEETRKKRPHRCDEGDPCRNCVKRKETCVRARPLSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 6, plas 5, nucl 2, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0016020  C:membrane  
GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG ttt:THITE_121911  -  
CDD cd00067  GAL4  
Amino Acid Sequences MDSLQATTFANTFLVTRNGGGPVLRVVGPEETRKKRPHRCDEGDPCRNCVKRKETCVRARPLSSSQDGSASPPPELPWRTLSEPECGPINLLHMELLHHFEQHTVHTLPFEPVWPRMLQLAFQNHHPRPLDLSGDRLYWLSTGVRQIFFMAWPLFQDRRSVFAHVAVLQPCMALEDAVHALGLNWQRHVRGFMALYENSRYRGGRNAFCSAGTSQTQSPPSSASSSSSLSSRDGSLTTPITGSSASTPGGAGSDTSIAAAYLEGLLPSLPSSSAPPYKVMTLWQSYKEGEAYVRSAGAHDEALTRAAYRRLAARLAVAMAFVSEGPGGGCAASGMSAGGVPGGGCRRLEVRRSDLVRYVTTIPMMCFGPLLALISGGDSRMLVLLFHVYRIVAALLPGETYWWCRRRVEVMQEAIGRELRSRGLEVCLRRQSEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.17
5 0.18
6 0.19
7 0.18
8 0.16
9 0.15
10 0.17
11 0.16
12 0.14
13 0.15
14 0.2
15 0.22
16 0.3
17 0.38
18 0.42
19 0.51
20 0.59
21 0.68
22 0.73
23 0.81
24 0.83
25 0.84
26 0.85
27 0.88
28 0.9
29 0.9
30 0.89
31 0.8
32 0.74
33 0.72
34 0.69
35 0.63
36 0.61
37 0.6
38 0.59
39 0.68
40 0.73
41 0.75
42 0.8
43 0.85
44 0.84
45 0.81
46 0.75
47 0.7
48 0.66
49 0.62
50 0.55
51 0.48
52 0.4
53 0.36
54 0.33
55 0.32
56 0.32
57 0.27
58 0.23
59 0.22
60 0.22
61 0.27
62 0.29
63 0.27
64 0.26
65 0.3
66 0.32
67 0.38
68 0.38
69 0.35
70 0.34
71 0.33
72 0.31
73 0.25
74 0.23
75 0.17
76 0.18
77 0.14
78 0.14
79 0.12
80 0.1
81 0.11
82 0.11
83 0.15
84 0.13
85 0.12
86 0.12
87 0.13
88 0.14
89 0.14
90 0.18
91 0.15
92 0.15
93 0.16
94 0.17
95 0.17
96 0.17
97 0.18
98 0.15
99 0.16
100 0.18
101 0.17
102 0.16
103 0.18
104 0.18
105 0.17
106 0.21
107 0.27
108 0.26
109 0.32
110 0.41
111 0.37
112 0.43
113 0.43
114 0.38
115 0.34
116 0.35
117 0.34
118 0.26
119 0.3
120 0.26
121 0.25
122 0.25
123 0.2
124 0.18
125 0.12
126 0.13
127 0.09
128 0.09
129 0.14
130 0.16
131 0.16
132 0.16
133 0.17
134 0.16
135 0.15
136 0.17
137 0.13
138 0.1
139 0.11
140 0.15
141 0.16
142 0.16
143 0.21
144 0.17
145 0.21
146 0.22
147 0.24
148 0.2
149 0.2
150 0.21
151 0.18
152 0.21
153 0.17
154 0.16
155 0.14
156 0.13
157 0.11
158 0.1
159 0.08
160 0.05
161 0.04
162 0.05
163 0.06
164 0.06
165 0.06
166 0.05
167 0.05
168 0.09
169 0.14
170 0.12
171 0.14
172 0.14
173 0.15
174 0.16
175 0.18
176 0.15
177 0.13
178 0.13
179 0.13
180 0.17
181 0.17
182 0.17
183 0.18
184 0.18
185 0.17
186 0.18
187 0.16
188 0.13
189 0.2
190 0.24
191 0.25
192 0.28
193 0.29
194 0.28
195 0.28
196 0.29
197 0.22
198 0.2
199 0.17
200 0.15
201 0.13
202 0.16
203 0.18
204 0.16
205 0.16
206 0.14
207 0.15
208 0.15
209 0.14
210 0.13
211 0.13
212 0.14
213 0.14
214 0.14
215 0.14
216 0.13
217 0.13
218 0.12
219 0.1
220 0.09
221 0.09
222 0.11
223 0.11
224 0.1
225 0.09
226 0.09
227 0.09
228 0.08
229 0.08
230 0.07
231 0.07
232 0.07
233 0.07
234 0.07
235 0.06
236 0.07
237 0.06
238 0.05
239 0.04
240 0.05
241 0.05
242 0.05
243 0.05
244 0.04
245 0.04
246 0.04
247 0.04
248 0.03
249 0.03
250 0.03
251 0.03
252 0.03
253 0.03
254 0.03
255 0.04
256 0.03
257 0.04
258 0.06
259 0.1
260 0.14
261 0.15
262 0.17
263 0.18
264 0.19
265 0.18
266 0.19
267 0.19
268 0.21
269 0.22
270 0.23
271 0.24
272 0.23
273 0.24
274 0.22
275 0.18
276 0.15
277 0.13
278 0.13
279 0.11
280 0.11
281 0.1
282 0.1
283 0.1
284 0.1
285 0.08
286 0.07
287 0.08
288 0.08
289 0.09
290 0.09
291 0.09
292 0.1
293 0.12
294 0.12
295 0.12
296 0.16
297 0.17
298 0.18
299 0.18
300 0.17
301 0.16
302 0.16
303 0.15
304 0.11
305 0.08
306 0.07
307 0.07
308 0.05
309 0.05
310 0.04
311 0.04
312 0.04
313 0.04
314 0.04
315 0.04
316 0.04
317 0.03
318 0.04
319 0.04
320 0.04
321 0.03
322 0.03
323 0.03
324 0.03
325 0.03
326 0.03
327 0.03
328 0.05
329 0.08
330 0.09
331 0.09
332 0.11
333 0.16
334 0.21
335 0.27
336 0.3
337 0.34
338 0.42
339 0.45
340 0.47
341 0.48
342 0.47
343 0.42
344 0.4
345 0.37
346 0.29
347 0.28
348 0.26
349 0.2
350 0.19
351 0.19
352 0.15
353 0.12
354 0.11
355 0.09
356 0.08
357 0.1
358 0.07
359 0.07
360 0.07
361 0.08
362 0.08
363 0.07
364 0.07
365 0.06
366 0.06
367 0.07
368 0.07
369 0.05
370 0.06
371 0.12
372 0.12
373 0.12
374 0.13
375 0.12
376 0.12
377 0.13
378 0.13
379 0.07
380 0.07
381 0.08
382 0.07
383 0.08
384 0.08
385 0.08
386 0.08
387 0.14
388 0.23
389 0.27
390 0.3
391 0.31
392 0.36
393 0.43
394 0.51
395 0.55
396 0.54
397 0.55
398 0.58
399 0.59
400 0.55
401 0.5
402 0.44
403 0.34
404 0.27
405 0.24
406 0.21
407 0.21
408 0.22
409 0.22
410 0.25
411 0.31
412 0.35
413 0.43
414 0.48