Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2RBJ4

Protein Details
Accession G2RBJ4   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
55-76TSTNHSRHSRSSRKIPRPTPSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
KEGG ttt:THITE_2170937  -  
Amino Acid Sequences MTRDKPAAQAATPTATASPAPVPADDPASYTRSTTMITAEEAAFGDMTSATTTTTSTNHSRHSRSSRKIPRPTPSSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.15
4 0.12
5 0.11
6 0.11
7 0.11
8 0.11
9 0.12
10 0.12
11 0.15
12 0.13
13 0.14
14 0.14
15 0.16
16 0.16
17 0.15
18 0.14
19 0.12
20 0.13
21 0.11
22 0.1
23 0.09
24 0.09
25 0.1
26 0.09
27 0.08
28 0.07
29 0.07
30 0.06
31 0.05
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.06
40 0.06
41 0.08
42 0.12
43 0.17
44 0.2
45 0.27
46 0.33
47 0.36
48 0.44
49 0.53
50 0.58
51 0.61
52 0.7
53 0.73
54 0.78
55 0.85
56 0.85
57 0.84