Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R7P0

Protein Details
Accession C4R7P0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-43VGPLPFKNPNWHRKKKYKPARQLINDEQKRHydrophilic
NLS Segment(s)
PositionSequence
26-31RKKKYK
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0034080  P:CENP-A containing chromatin assembly  
KEGG ppa:PAS_chr4_0370  -  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MSQEELDRVSDMLVGPLPFKNPNWHRKKKYKPARQLINDEQKRINSKENRTFDEVNYFTVQAPPSLKPRKTYCDITGLPTSYRAPHSQIRFYNMEVYEVVKNMASGVDQQYLGLRGANVVLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.15
5 0.16
6 0.17
7 0.27
8 0.33
9 0.43
10 0.52
11 0.62
12 0.7
13 0.78
14 0.87
15 0.88
16 0.91
17 0.91
18 0.91
19 0.91
20 0.92
21 0.88
22 0.86
23 0.84
24 0.84
25 0.76
26 0.68
27 0.6
28 0.53
29 0.51
30 0.45
31 0.44
32 0.4
33 0.46
34 0.52
35 0.55
36 0.55
37 0.56
38 0.54
39 0.46
40 0.46
41 0.38
42 0.31
43 0.27
44 0.24
45 0.18
46 0.19
47 0.18
48 0.12
49 0.13
50 0.12
51 0.2
52 0.27
53 0.28
54 0.31
55 0.35
56 0.4
57 0.43
58 0.47
59 0.41
60 0.42
61 0.41
62 0.4
63 0.39
64 0.34
65 0.29
66 0.26
67 0.25
68 0.19
69 0.21
70 0.18
71 0.19
72 0.25
73 0.29
74 0.35
75 0.36
76 0.4
77 0.39
78 0.39
79 0.41
80 0.34
81 0.32
82 0.24
83 0.25
84 0.2
85 0.19
86 0.18
87 0.11
88 0.11
89 0.1
90 0.1
91 0.07
92 0.09
93 0.12
94 0.14
95 0.14
96 0.14
97 0.16
98 0.17
99 0.17
100 0.15
101 0.12
102 0.1