Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R964

Protein Details
Accession G2R964    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
127-180ERQAREKRAAERKRKAQAAIPARFRKKVRIEQPAPRPPRPKKKSERTSWLPSPAHydrophilic
NLS Segment(s)
PositionSequence
129-171QAREKRAAERKRKAQAAIPARFRKKVRIEQPAPRPPRPKKKSE
210-222RRKQLEKMEKKAK
Subcellular Location(s) nucl 18, cyto 6, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008895  Vps72/YL1  
IPR013272  Vps72/YL1_C  
IPR046757  YL1_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0140849  F:ATP-dependent H2AZ histone chaperone activity  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG ttt:THITE_2119900  -  
Pfam View protein in Pfam  
PF05764  YL1  
PF08265  YL1_C  
Amino Acid Sequences MATDEDENKSSSLDDLSDIDSTSSSSGAEGDGDGDGDGDSEPAKVEWLVTSRAKRATAGNRMKSMLANEVPADDDSDLELLFAEDENDAGFSEDEQDDASDMQMDSSSDDEDKEDNGDELEGEKELERQAREKRAAERKRKAQAAIPARFRKKVRIEQPAPRPPRPKKKSERTSWLPSPADMPTRASERQTTKISKQQLHQRMVSDELRRRKQLEKMEKKAKLLEATKKPPMTQAERLAEAAIVEKRNAKSLNRWEEAEKQREEERLKKIAALNSRKLDGPVVTFWSGIQELQEGQGNHVGNLVSMEEKAPRKKRQSAAAALAAKEAEAAAAAAAPTSPVEKTDDPQTLETPQPQTGEQADKLPLPEPPSVPPQPTPVDSGQATAPGPAPAPAPAPAPEATPASASSQMAPPPIPPPPDSRPSSSGVLAAPVLAPPIGVSPPMLGGQMPMLALPAGGAKSVLAAPNTSHTPFPLSMPPATPSVAAPPATPPVSTPTPKPTVPPPPLPSAPVTPSQTPQPKTAPPSARPPDTPQEAPPPAVEPPREGKVTRSCIILQNFDEQAIKDKQVQTQILFGRKMNKLAKPAHPPLCVITNHPARYRDPKTGLPYYNSYAYREIQRVYRGDYKWSKLLGAWVGRGDYAARGVPEWFLDPSKAPKPAEPESVPEDAAAEVKTEEEKKEQKQPADEPRLVPLEADKPPTTEMPAATQAVGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.15
4 0.15
5 0.15
6 0.14
7 0.13
8 0.13
9 0.12
10 0.1
11 0.08
12 0.07
13 0.07
14 0.07
15 0.08
16 0.07
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.07
29 0.06
30 0.08
31 0.07
32 0.08
33 0.11
34 0.14
35 0.19
36 0.25
37 0.3
38 0.34
39 0.38
40 0.39
41 0.38
42 0.43
43 0.47
44 0.52
45 0.58
46 0.59
47 0.59
48 0.59
49 0.58
50 0.52
51 0.45
52 0.41
53 0.32
54 0.27
55 0.24
56 0.23
57 0.23
58 0.21
59 0.2
60 0.13
61 0.12
62 0.1
63 0.11
64 0.1
65 0.08
66 0.08
67 0.06
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.06
79 0.1
80 0.1
81 0.1
82 0.1
83 0.1
84 0.1
85 0.1
86 0.1
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.08
93 0.09
94 0.1
95 0.09
96 0.09
97 0.11
98 0.11
99 0.11
100 0.12
101 0.12
102 0.11
103 0.11
104 0.1
105 0.09
106 0.09
107 0.09
108 0.08
109 0.08
110 0.08
111 0.09
112 0.12
113 0.16
114 0.17
115 0.22
116 0.3
117 0.38
118 0.43
119 0.46
120 0.53
121 0.6
122 0.69
123 0.73
124 0.76
125 0.76
126 0.8
127 0.8
128 0.73
129 0.69
130 0.68
131 0.67
132 0.65
133 0.66
134 0.66
135 0.65
136 0.69
137 0.65
138 0.65
139 0.64
140 0.66
141 0.66
142 0.68
143 0.7
144 0.73
145 0.82
146 0.83
147 0.81
148 0.78
149 0.79
150 0.78
151 0.82
152 0.8
153 0.8
154 0.81
155 0.85
156 0.88
157 0.87
158 0.88
159 0.84
160 0.86
161 0.81
162 0.79
163 0.68
164 0.58
165 0.51
166 0.43
167 0.39
168 0.31
169 0.27
170 0.22
171 0.26
172 0.27
173 0.26
174 0.3
175 0.31
176 0.36
177 0.4
178 0.43
179 0.44
180 0.49
181 0.55
182 0.53
183 0.55
184 0.6
185 0.62
186 0.61
187 0.59
188 0.54
189 0.48
190 0.49
191 0.47
192 0.44
193 0.42
194 0.46
195 0.49
196 0.5
197 0.51
198 0.51
199 0.53
200 0.57
201 0.61
202 0.62
203 0.67
204 0.74
205 0.74
206 0.71
207 0.68
208 0.6
209 0.56
210 0.52
211 0.52
212 0.51
213 0.53
214 0.58
215 0.55
216 0.52
217 0.5
218 0.5
219 0.47
220 0.44
221 0.46
222 0.43
223 0.42
224 0.42
225 0.37
226 0.31
227 0.24
228 0.2
229 0.14
230 0.12
231 0.12
232 0.16
233 0.16
234 0.21
235 0.23
236 0.22
237 0.28
238 0.37
239 0.46
240 0.43
241 0.44
242 0.43
243 0.5
244 0.56
245 0.54
246 0.45
247 0.39
248 0.39
249 0.43
250 0.44
251 0.42
252 0.4
253 0.38
254 0.38
255 0.38
256 0.39
257 0.38
258 0.43
259 0.43
260 0.43
261 0.4
262 0.41
263 0.38
264 0.35
265 0.32
266 0.23
267 0.19
268 0.14
269 0.16
270 0.15
271 0.14
272 0.14
273 0.14
274 0.13
275 0.11
276 0.1
277 0.07
278 0.06
279 0.07
280 0.11
281 0.09
282 0.1
283 0.14
284 0.13
285 0.13
286 0.14
287 0.13
288 0.1
289 0.1
290 0.09
291 0.06
292 0.06
293 0.06
294 0.09
295 0.13
296 0.21
297 0.28
298 0.35
299 0.42
300 0.5
301 0.54
302 0.59
303 0.62
304 0.6
305 0.57
306 0.56
307 0.5
308 0.42
309 0.38
310 0.29
311 0.21
312 0.16
313 0.11
314 0.05
315 0.03
316 0.03
317 0.02
318 0.02
319 0.02
320 0.02
321 0.02
322 0.02
323 0.03
324 0.03
325 0.04
326 0.04
327 0.08
328 0.09
329 0.1
330 0.16
331 0.18
332 0.19
333 0.2
334 0.21
335 0.19
336 0.2
337 0.21
338 0.18
339 0.16
340 0.16
341 0.15
342 0.15
343 0.15
344 0.17
345 0.15
346 0.15
347 0.14
348 0.14
349 0.15
350 0.14
351 0.13
352 0.14
353 0.15
354 0.14
355 0.16
356 0.21
357 0.22
358 0.23
359 0.23
360 0.23
361 0.23
362 0.23
363 0.25
364 0.19
365 0.21
366 0.19
367 0.19
368 0.15
369 0.15
370 0.14
371 0.1
372 0.1
373 0.08
374 0.08
375 0.07
376 0.08
377 0.07
378 0.08
379 0.08
380 0.09
381 0.09
382 0.11
383 0.11
384 0.12
385 0.12
386 0.12
387 0.11
388 0.11
389 0.11
390 0.1
391 0.11
392 0.11
393 0.1
394 0.11
395 0.12
396 0.12
397 0.12
398 0.11
399 0.11
400 0.14
401 0.15
402 0.15
403 0.21
404 0.25
405 0.31
406 0.33
407 0.36
408 0.36
409 0.37
410 0.38
411 0.32
412 0.29
413 0.22
414 0.19
415 0.15
416 0.12
417 0.08
418 0.06
419 0.06
420 0.04
421 0.04
422 0.03
423 0.04
424 0.04
425 0.04
426 0.05
427 0.05
428 0.06
429 0.06
430 0.06
431 0.05
432 0.05
433 0.06
434 0.06
435 0.06
436 0.05
437 0.04
438 0.04
439 0.04
440 0.04
441 0.04
442 0.04
443 0.04
444 0.04
445 0.04
446 0.05
447 0.06
448 0.07
449 0.07
450 0.07
451 0.08
452 0.11
453 0.13
454 0.13
455 0.13
456 0.12
457 0.15
458 0.15
459 0.17
460 0.19
461 0.19
462 0.19
463 0.21
464 0.22
465 0.2
466 0.2
467 0.18
468 0.13
469 0.14
470 0.16
471 0.15
472 0.13
473 0.14
474 0.17
475 0.17
476 0.16
477 0.14
478 0.17
479 0.22
480 0.23
481 0.24
482 0.27
483 0.31
484 0.32
485 0.34
486 0.35
487 0.4
488 0.44
489 0.49
490 0.46
491 0.48
492 0.49
493 0.49
494 0.44
495 0.38
496 0.35
497 0.32
498 0.32
499 0.27
500 0.28
501 0.34
502 0.39
503 0.38
504 0.4
505 0.39
506 0.4
507 0.43
508 0.51
509 0.5
510 0.45
511 0.54
512 0.56
513 0.55
514 0.53
515 0.54
516 0.52
517 0.51
518 0.5
519 0.43
520 0.46
521 0.43
522 0.41
523 0.36
524 0.3
525 0.27
526 0.3
527 0.27
528 0.22
529 0.25
530 0.28
531 0.3
532 0.28
533 0.31
534 0.36
535 0.42
536 0.4
537 0.38
538 0.36
539 0.4
540 0.43
541 0.41
542 0.34
543 0.32
544 0.31
545 0.29
546 0.28
547 0.21
548 0.25
549 0.23
550 0.23
551 0.24
552 0.26
553 0.29
554 0.35
555 0.37
556 0.32
557 0.36
558 0.39
559 0.4
560 0.39
561 0.37
562 0.38
563 0.37
564 0.44
565 0.44
566 0.43
567 0.45
568 0.5
569 0.57
570 0.58
571 0.65
572 0.64
573 0.6
574 0.56
575 0.51
576 0.51
577 0.43
578 0.38
579 0.39
580 0.39
581 0.42
582 0.45
583 0.45
584 0.44
585 0.53
586 0.54
587 0.53
588 0.5
589 0.53
590 0.56
591 0.61
592 0.6
593 0.55
594 0.55
595 0.5
596 0.52
597 0.46
598 0.42
599 0.37
600 0.36
601 0.37
602 0.36
603 0.34
604 0.32
605 0.36
606 0.36
607 0.39
608 0.44
609 0.4
610 0.46
611 0.51
612 0.51
613 0.51
614 0.49
615 0.44
616 0.36
617 0.41
618 0.38
619 0.34
620 0.31
621 0.27
622 0.26
623 0.25
624 0.25
625 0.2
626 0.14
627 0.13
628 0.13
629 0.12
630 0.12
631 0.13
632 0.13
633 0.14
634 0.15
635 0.15
636 0.15
637 0.16
638 0.18
639 0.25
640 0.3
641 0.35
642 0.35
643 0.36
644 0.42
645 0.45
646 0.51
647 0.46
648 0.45
649 0.44
650 0.45
651 0.41
652 0.33
653 0.29
654 0.2
655 0.2
656 0.15
657 0.11
658 0.09
659 0.1
660 0.14
661 0.16
662 0.18
663 0.25
664 0.33
665 0.38
666 0.48
667 0.54
668 0.56
669 0.61
670 0.68
671 0.71
672 0.73
673 0.71
674 0.62
675 0.61
676 0.58
677 0.5
678 0.42
679 0.35
680 0.33
681 0.32
682 0.37
683 0.32
684 0.3
685 0.33
686 0.34
687 0.34
688 0.3
689 0.28
690 0.27
691 0.3
692 0.3