Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QZF1

Protein Details
Accession G2QZF1   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-37QEMVGLRRRKRQLQISEPFDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 7
Family & Domain DBs
KEGG ttt:THITE_2116017  -  
Amino Acid Sequences MAAMNVYSEVKRFYTSLQEMVGLRRRKRQLQISEPFDFKKETVILPGLTDGEISVLREKAAASRLGIAAIDADHLPPTTTTAATTTTITTSTTSFPIPSPSPSTTAASSSGYFPPSIAPPRRTSRLSSAPPRLSLPIPIPVPTPNAHHAAAARRHGSAGGAGSFSLRGSSTVGGSAAAGVGVGMGMGMEGGREVEGAGFGAGAGGAGMRTSVSANDLDLLLFGNPSGVGGAGDGCGKEGVVVTAISPVDLHGGAPVINAGDVGGAGSLEVQTRRLDLLEMDFEFQLGSPVSPLEPSLGGVVAERKVLVGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.29
4 0.28
5 0.3
6 0.29
7 0.35
8 0.42
9 0.4
10 0.41
11 0.47
12 0.54
13 0.59
14 0.67
15 0.7
16 0.72
17 0.74
18 0.8
19 0.78
20 0.76
21 0.71
22 0.63
23 0.55
24 0.47
25 0.36
26 0.32
27 0.27
28 0.22
29 0.24
30 0.25
31 0.23
32 0.22
33 0.23
34 0.18
35 0.15
36 0.14
37 0.1
38 0.08
39 0.08
40 0.09
41 0.1
42 0.1
43 0.1
44 0.11
45 0.11
46 0.13
47 0.15
48 0.16
49 0.14
50 0.17
51 0.17
52 0.17
53 0.16
54 0.13
55 0.1
56 0.08
57 0.09
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.09
65 0.09
66 0.09
67 0.1
68 0.1
69 0.12
70 0.13
71 0.14
72 0.12
73 0.11
74 0.11
75 0.11
76 0.11
77 0.11
78 0.11
79 0.11
80 0.11
81 0.12
82 0.12
83 0.16
84 0.16
85 0.18
86 0.21
87 0.21
88 0.24
89 0.25
90 0.27
91 0.23
92 0.23
93 0.22
94 0.18
95 0.17
96 0.17
97 0.16
98 0.15
99 0.14
100 0.13
101 0.12
102 0.14
103 0.21
104 0.24
105 0.26
106 0.31
107 0.36
108 0.41
109 0.41
110 0.42
111 0.42
112 0.46
113 0.49
114 0.51
115 0.54
116 0.52
117 0.51
118 0.48
119 0.43
120 0.35
121 0.3
122 0.23
123 0.2
124 0.19
125 0.18
126 0.17
127 0.16
128 0.18
129 0.17
130 0.18
131 0.16
132 0.18
133 0.18
134 0.18
135 0.18
136 0.22
137 0.24
138 0.24
139 0.22
140 0.19
141 0.19
142 0.19
143 0.17
144 0.12
145 0.09
146 0.07
147 0.06
148 0.06
149 0.06
150 0.06
151 0.05
152 0.05
153 0.04
154 0.04
155 0.05
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.05
163 0.04
164 0.03
165 0.03
166 0.02
167 0.02
168 0.02
169 0.02
170 0.01
171 0.01
172 0.01
173 0.01
174 0.01
175 0.01
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.02
189 0.02
190 0.02
191 0.02
192 0.02
193 0.02
194 0.02
195 0.02
196 0.03
197 0.03
198 0.04
199 0.05
200 0.06
201 0.06
202 0.07
203 0.07
204 0.06
205 0.06
206 0.07
207 0.05
208 0.05
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.03
215 0.03
216 0.04
217 0.04
218 0.04
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.05
227 0.06
228 0.06
229 0.05
230 0.08
231 0.08
232 0.08
233 0.08
234 0.08
235 0.08
236 0.08
237 0.08
238 0.06
239 0.06
240 0.06
241 0.06
242 0.07
243 0.05
244 0.05
245 0.05
246 0.04
247 0.04
248 0.03
249 0.04
250 0.03
251 0.03
252 0.03
253 0.03
254 0.04
255 0.06
256 0.07
257 0.08
258 0.09
259 0.1
260 0.11
261 0.11
262 0.12
263 0.11
264 0.15
265 0.18
266 0.19
267 0.2
268 0.19
269 0.18
270 0.17
271 0.16
272 0.14
273 0.1
274 0.09
275 0.07
276 0.08
277 0.09
278 0.09
279 0.1
280 0.1
281 0.1
282 0.1
283 0.11
284 0.11
285 0.1
286 0.11
287 0.14
288 0.13
289 0.13
290 0.12