Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QWU8

Protein Details
Accession G2QWU8   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
70-90KFPLPGRKPPVHRPKPLRELGBasic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 10, pero 5, nucl 4.5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007325  KFase/CYL  
IPR037175  KFase_sf  
Gene Ontology GO:0004061  F:arylformamidase activity  
GO:0019441  P:tryptophan catabolic process to kynurenine  
KEGG ttt:THITE_2107984  -  
Pfam View protein in Pfam  
PF04199  Cyclase  
Amino Acid Sequences MDPASVPDFDDLPKVDGQPQGCAWGLFDKDGKKDVFGTLNFLTPSIVAAAAAEVKDGVSISLNWPLNGIKFPLPGRKPPVHRPKPLRELGIDCEGWDDELDFNTQFSSQWDGLCHFTPGGATYNGLKPTQQGLEVQSTAENGLPTIEHWHSRGALVGRGVLIDWKRFHEETTGTPYHPLDGYRITPEDIEKVARHQGVEFKHGDILIVRTGYTEVLEAPTQEDFAKFQAQTLSGVHGTVETARWVWNHRFAAVAGDAHAFEALPPLKPDGTPGSVTEPVLHHWFLNQFGMPIGELWDLKALSEYAKKTGRYSFLLTSVPLNHPGLVASPPNAIALF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.26
4 0.26
5 0.26
6 0.25
7 0.26
8 0.25
9 0.23
10 0.21
11 0.22
12 0.22
13 0.2
14 0.24
15 0.24
16 0.26
17 0.32
18 0.31
19 0.27
20 0.28
21 0.29
22 0.31
23 0.28
24 0.31
25 0.27
26 0.3
27 0.28
28 0.26
29 0.23
30 0.16
31 0.16
32 0.11
33 0.1
34 0.06
35 0.06
36 0.06
37 0.08
38 0.08
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.08
48 0.16
49 0.17
50 0.16
51 0.18
52 0.18
53 0.18
54 0.19
55 0.2
56 0.15
57 0.18
58 0.21
59 0.29
60 0.32
61 0.37
62 0.44
63 0.49
64 0.53
65 0.6
66 0.69
67 0.69
68 0.75
69 0.78
70 0.8
71 0.81
72 0.8
73 0.73
74 0.65
75 0.59
76 0.54
77 0.5
78 0.39
79 0.3
80 0.26
81 0.23
82 0.19
83 0.15
84 0.12
85 0.07
86 0.07
87 0.09
88 0.07
89 0.07
90 0.08
91 0.08
92 0.07
93 0.08
94 0.13
95 0.12
96 0.13
97 0.14
98 0.15
99 0.18
100 0.18
101 0.17
102 0.12
103 0.11
104 0.11
105 0.11
106 0.12
107 0.09
108 0.1
109 0.11
110 0.15
111 0.17
112 0.16
113 0.15
114 0.14
115 0.16
116 0.17
117 0.15
118 0.13
119 0.14
120 0.17
121 0.17
122 0.16
123 0.13
124 0.12
125 0.12
126 0.11
127 0.09
128 0.05
129 0.05
130 0.05
131 0.05
132 0.09
133 0.1
134 0.1
135 0.11
136 0.12
137 0.12
138 0.13
139 0.15
140 0.12
141 0.12
142 0.12
143 0.11
144 0.1
145 0.09
146 0.09
147 0.09
148 0.09
149 0.1
150 0.11
151 0.12
152 0.16
153 0.16
154 0.17
155 0.17
156 0.17
157 0.17
158 0.24
159 0.23
160 0.2
161 0.21
162 0.21
163 0.19
164 0.18
165 0.16
166 0.1
167 0.11
168 0.12
169 0.12
170 0.13
171 0.13
172 0.12
173 0.13
174 0.13
175 0.11
176 0.12
177 0.11
178 0.12
179 0.16
180 0.16
181 0.16
182 0.15
183 0.19
184 0.19
185 0.23
186 0.22
187 0.19
188 0.19
189 0.19
190 0.18
191 0.13
192 0.13
193 0.1
194 0.09
195 0.08
196 0.08
197 0.08
198 0.08
199 0.07
200 0.06
201 0.05
202 0.07
203 0.07
204 0.07
205 0.08
206 0.08
207 0.08
208 0.08
209 0.08
210 0.07
211 0.09
212 0.13
213 0.12
214 0.13
215 0.14
216 0.15
217 0.16
218 0.16
219 0.17
220 0.13
221 0.13
222 0.12
223 0.1
224 0.09
225 0.09
226 0.09
227 0.06
228 0.07
229 0.08
230 0.09
231 0.14
232 0.17
233 0.24
234 0.25
235 0.24
236 0.25
237 0.24
238 0.26
239 0.23
240 0.2
241 0.13
242 0.13
243 0.12
244 0.11
245 0.11
246 0.07
247 0.06
248 0.11
249 0.11
250 0.11
251 0.12
252 0.14
253 0.15
254 0.15
255 0.19
256 0.18
257 0.2
258 0.21
259 0.21
260 0.25
261 0.26
262 0.26
263 0.25
264 0.21
265 0.21
266 0.24
267 0.23
268 0.17
269 0.18
270 0.19
271 0.19
272 0.2
273 0.17
274 0.14
275 0.14
276 0.15
277 0.13
278 0.11
279 0.12
280 0.11
281 0.11
282 0.11
283 0.14
284 0.13
285 0.13
286 0.14
287 0.12
288 0.14
289 0.2
290 0.21
291 0.24
292 0.3
293 0.32
294 0.34
295 0.4
296 0.41
297 0.4
298 0.44
299 0.4
300 0.38
301 0.39
302 0.36
303 0.34
304 0.33
305 0.31
306 0.3
307 0.28
308 0.24
309 0.23
310 0.22
311 0.2
312 0.19
313 0.19
314 0.16
315 0.16
316 0.16