Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R5X3

Protein Details
Accession G2R5X3   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
59-78VRSGRPRKGEAPKKKQNAEPBasic
NLS Segment(s)
PositionSequence
51-73KKKTPTVGVRSGRPRKGEAPKKK
Subcellular Location(s) mito 14, nucl 7, cyto 6
Family & Domain DBs
KEGG ttt:THITE_2117851  -  
Amino Acid Sequences MGRPPGSVGRPQLKVEDLLRIQTLSRDARMGPTQISKITGYSLHQIKYALKKKTPTVGVRSGRPRKGEAPKKKQNAEPASVPAGRQDTVMGEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.35
4 0.28
5 0.27
6 0.26
7 0.23
8 0.22
9 0.2
10 0.24
11 0.18
12 0.18
13 0.17
14 0.16
15 0.2
16 0.22
17 0.21
18 0.18
19 0.19
20 0.2
21 0.19
22 0.21
23 0.17
24 0.15
25 0.15
26 0.14
27 0.12
28 0.16
29 0.18
30 0.16
31 0.17
32 0.17
33 0.19
34 0.28
35 0.34
36 0.32
37 0.33
38 0.35
39 0.37
40 0.43
41 0.47
42 0.42
43 0.41
44 0.46
45 0.47
46 0.5
47 0.58
48 0.6
49 0.57
50 0.56
51 0.53
52 0.52
53 0.6
54 0.64
55 0.65
56 0.67
57 0.73
58 0.79
59 0.81
60 0.78
61 0.77
62 0.73
63 0.67
64 0.6
65 0.54
66 0.51
67 0.46
68 0.41
69 0.35
70 0.31
71 0.26
72 0.23
73 0.19
74 0.15