Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QV49

Protein Details
Accession G2QV49    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MAQKKKKKKKTYSTGDSLVVHydrophilic
NLS Segment(s)
PositionSequence
4-10KKKKKKK
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
KEGG ttt:THITE_2037701  -  
Amino Acid Sequences MAQKKKKKKKTYSTGDSLVVTDPTTNPAVGSLSRGERTGSRVFYHLWPYVTVTPAHSLEMEPLHNKHLKIPRWHGLQQHLYGRREAGRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.74
3 0.63
4 0.53
5 0.43
6 0.32
7 0.23
8 0.16
9 0.12
10 0.12
11 0.12
12 0.11
13 0.1
14 0.1
15 0.1
16 0.1
17 0.11
18 0.11
19 0.12
20 0.13
21 0.13
22 0.14
23 0.13
24 0.18
25 0.2
26 0.19
27 0.18
28 0.19
29 0.2
30 0.21
31 0.25
32 0.22
33 0.19
34 0.17
35 0.19
36 0.19
37 0.18
38 0.17
39 0.13
40 0.14
41 0.14
42 0.15
43 0.12
44 0.11
45 0.11
46 0.13
47 0.13
48 0.13
49 0.13
50 0.18
51 0.21
52 0.21
53 0.27
54 0.34
55 0.39
56 0.45
57 0.52
58 0.56
59 0.6
60 0.64
61 0.62
62 0.62
63 0.62
64 0.59
65 0.61
66 0.6
67 0.55
68 0.52
69 0.5