Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R627

Protein Details
Accession G2R627   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-22PHPITSIKTRGQRKRRLAGAIHydrophilic
181-203SPTSSPSTPKPKKPEPTATNPNTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004843  Calcineurin-like_PHP_ApaH  
IPR029052  Metallo-depent_PP-like  
Gene Ontology GO:0016787  F:hydrolase activity  
KEGG ttt:THITE_2116460  -  
Pfam View protein in Pfam  
PF00149  Metallophos  
CDD cd07379  MPP_239FB  
Amino Acid Sequences MPHPITSIKTRGQRKRRLAGAILARHCVKPCATAPPDPVRVVCVSDTHNKQPVLPPGDILIHAGDLTKNGSFDEVQAGVTWLSSQPHRFKILVAGNHDVLLDETFLERYPERRYGQSKTKKDLDWGDVIYLEDSTITLDVPVQPSPPAQAEPPTAPGRRNTASRPSSTRRPRAPSTGAPASPTSSPSTPKPKKPEPTATNPNTTGQPRLWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.81
4 0.79
5 0.73
6 0.7
7 0.69
8 0.67
9 0.6
10 0.55
11 0.5
12 0.45
13 0.43
14 0.37
15 0.29
16 0.25
17 0.26
18 0.31
19 0.33
20 0.36
21 0.41
22 0.46
23 0.49
24 0.45
25 0.43
26 0.36
27 0.33
28 0.3
29 0.24
30 0.19
31 0.19
32 0.26
33 0.31
34 0.33
35 0.38
36 0.37
37 0.37
38 0.41
39 0.45
40 0.42
41 0.37
42 0.32
43 0.27
44 0.28
45 0.27
46 0.22
47 0.13
48 0.09
49 0.08
50 0.08
51 0.07
52 0.06
53 0.08
54 0.07
55 0.07
56 0.07
57 0.08
58 0.08
59 0.08
60 0.1
61 0.09
62 0.09
63 0.09
64 0.09
65 0.08
66 0.08
67 0.07
68 0.06
69 0.06
70 0.08
71 0.13
72 0.16
73 0.19
74 0.22
75 0.22
76 0.21
77 0.28
78 0.31
79 0.3
80 0.3
81 0.29
82 0.26
83 0.26
84 0.26
85 0.18
86 0.13
87 0.1
88 0.07
89 0.04
90 0.04
91 0.04
92 0.05
93 0.06
94 0.06
95 0.08
96 0.11
97 0.17
98 0.18
99 0.23
100 0.27
101 0.32
102 0.42
103 0.5
104 0.52
105 0.52
106 0.56
107 0.52
108 0.53
109 0.51
110 0.44
111 0.37
112 0.32
113 0.26
114 0.21
115 0.2
116 0.16
117 0.12
118 0.08
119 0.05
120 0.04
121 0.04
122 0.04
123 0.04
124 0.03
125 0.04
126 0.05
127 0.07
128 0.08
129 0.08
130 0.08
131 0.09
132 0.11
133 0.12
134 0.12
135 0.11
136 0.14
137 0.17
138 0.17
139 0.22
140 0.26
141 0.26
142 0.26
143 0.28
144 0.31
145 0.32
146 0.34
147 0.34
148 0.39
149 0.42
150 0.45
151 0.5
152 0.5
153 0.58
154 0.64
155 0.68
156 0.67
157 0.7
158 0.7
159 0.7
160 0.7
161 0.66
162 0.65
163 0.63
164 0.55
165 0.5
166 0.46
167 0.4
168 0.34
169 0.31
170 0.27
171 0.22
172 0.25
173 0.3
174 0.4
175 0.45
176 0.54
177 0.61
178 0.66
179 0.73
180 0.79
181 0.83
182 0.8
183 0.82
184 0.84
185 0.8
186 0.78
187 0.7
188 0.63
189 0.58
190 0.53
191 0.47