Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R3W8

Protein Details
Accession G2R3W8   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
82-104QLAGHKHTVRRKRVRETLESRPGBasic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
KEGG ttt:THITE_2115273  -  
Amino Acid Sequences MRLRNQATAVRAPAFGKAASCKQPKSLVVWPHMQQTQDLVSPQHVGVRDKTLSETRWERAMRHSDLSHFTSCQEEGAREGAQLAGHKHTVRRKRVRETLESRPGMSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.19
4 0.2
5 0.24
6 0.31
7 0.36
8 0.35
9 0.37
10 0.42
11 0.41
12 0.43
13 0.45
14 0.42
15 0.41
16 0.45
17 0.43
18 0.43
19 0.43
20 0.37
21 0.29
22 0.25
23 0.23
24 0.19
25 0.18
26 0.13
27 0.12
28 0.13
29 0.13
30 0.13
31 0.13
32 0.13
33 0.14
34 0.17
35 0.16
36 0.15
37 0.18
38 0.18
39 0.17
40 0.2
41 0.22
42 0.19
43 0.25
44 0.25
45 0.24
46 0.28
47 0.33
48 0.31
49 0.32
50 0.31
51 0.28
52 0.31
53 0.33
54 0.29
55 0.23
56 0.21
57 0.19
58 0.19
59 0.18
60 0.14
61 0.11
62 0.11
63 0.14
64 0.13
65 0.11
66 0.11
67 0.1
68 0.11
69 0.12
70 0.13
71 0.13
72 0.16
73 0.17
74 0.23
75 0.32
76 0.4
77 0.49
78 0.58
79 0.64
80 0.71
81 0.79
82 0.81
83 0.82
84 0.8
85 0.8
86 0.8
87 0.73