Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2QVZ8

Protein Details
Accession G2QVZ8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
404-423ERRKRVCGTGPGRPWRQRRRBasic
NLS Segment(s)
PositionSequence
415-423GRPWRQRRR
Subcellular Location(s) mito 10, nucl 7.5, cyto_nucl 6, plas 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016740  F:transferase activity  
KEGG ttt:THITE_2111010  -  
Amino Acid Sequences MAVWRFGAPRYSLLRRDALAADQSATDATASPPRSRFALADVWSSRRLRLWVPVLLTAMVLLVSGSRRFHTPSVRTWRPATDGTPADERRPEPPPVTSKPPPLPSPAPPSPSWPEGPALAGSVDWSRFAYTQYVTDLHYLCNSVMLFERLHHLGSRAGRVMMYPSHMFDPTAADGGTSVEARLLRKARDEYNVRLVPIQVQRRDGGDKTWAESYTKLLAFNQTQYDRVLSLDSDSVVLQHMDELFLLPPCPMAMPRAYWLYPEKKVLSSQVMLLQPSEAEFARVMDKINAAADDDYDMEIVNQLYGDSAMVLPHRPYDLLTGEFRHDPDEHAAYLGSEREKWDPVAAFNEAKFLHFSDWPLPKPWLVSEAQRLANQPKCHQRDGGVESCAEREIWNGIYADFAERRKRVCGTGPGRPWRQRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.43
3 0.45
4 0.4
5 0.36
6 0.32
7 0.28
8 0.25
9 0.21
10 0.2
11 0.16
12 0.15
13 0.12
14 0.08
15 0.1
16 0.15
17 0.18
18 0.23
19 0.25
20 0.27
21 0.29
22 0.3
23 0.29
24 0.27
25 0.32
26 0.29
27 0.35
28 0.36
29 0.37
30 0.41
31 0.41
32 0.38
33 0.33
34 0.34
35 0.29
36 0.34
37 0.36
38 0.35
39 0.36
40 0.37
41 0.35
42 0.32
43 0.29
44 0.21
45 0.15
46 0.1
47 0.07
48 0.05
49 0.05
50 0.06
51 0.09
52 0.1
53 0.11
54 0.14
55 0.17
56 0.22
57 0.3
58 0.33
59 0.4
60 0.5
61 0.55
62 0.57
63 0.56
64 0.55
65 0.5
66 0.49
67 0.41
68 0.39
69 0.35
70 0.34
71 0.4
72 0.38
73 0.36
74 0.38
75 0.37
76 0.34
77 0.36
78 0.36
79 0.3
80 0.35
81 0.39
82 0.41
83 0.48
84 0.49
85 0.52
86 0.55
87 0.58
88 0.54
89 0.54
90 0.52
91 0.49
92 0.54
93 0.5
94 0.48
95 0.43
96 0.47
97 0.45
98 0.44
99 0.4
100 0.32
101 0.28
102 0.24
103 0.25
104 0.19
105 0.15
106 0.11
107 0.09
108 0.09
109 0.09
110 0.09
111 0.08
112 0.08
113 0.09
114 0.09
115 0.11
116 0.12
117 0.12
118 0.13
119 0.14
120 0.15
121 0.15
122 0.18
123 0.17
124 0.15
125 0.15
126 0.15
127 0.12
128 0.13
129 0.12
130 0.1
131 0.1
132 0.11
133 0.11
134 0.1
135 0.14
136 0.12
137 0.13
138 0.12
139 0.12
140 0.15
141 0.16
142 0.19
143 0.17
144 0.16
145 0.16
146 0.15
147 0.16
148 0.13
149 0.14
150 0.12
151 0.12
152 0.14
153 0.14
154 0.14
155 0.12
156 0.14
157 0.11
158 0.12
159 0.1
160 0.08
161 0.08
162 0.09
163 0.09
164 0.06
165 0.05
166 0.06
167 0.07
168 0.08
169 0.13
170 0.14
171 0.15
172 0.19
173 0.22
174 0.23
175 0.29
176 0.33
177 0.32
178 0.39
179 0.4
180 0.36
181 0.34
182 0.31
183 0.29
184 0.31
185 0.34
186 0.26
187 0.27
188 0.27
189 0.28
190 0.31
191 0.26
192 0.21
193 0.2
194 0.19
195 0.19
196 0.2
197 0.19
198 0.17
199 0.17
200 0.17
201 0.16
202 0.16
203 0.15
204 0.13
205 0.16
206 0.16
207 0.17
208 0.2
209 0.16
210 0.17
211 0.17
212 0.17
213 0.14
214 0.13
215 0.12
216 0.08
217 0.08
218 0.07
219 0.07
220 0.07
221 0.06
222 0.06
223 0.06
224 0.06
225 0.05
226 0.05
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.06
233 0.06
234 0.05
235 0.05
236 0.05
237 0.06
238 0.05
239 0.07
240 0.08
241 0.09
242 0.11
243 0.14
244 0.14
245 0.16
246 0.21
247 0.24
248 0.25
249 0.28
250 0.28
251 0.26
252 0.27
253 0.28
254 0.27
255 0.22
256 0.21
257 0.23
258 0.22
259 0.21
260 0.2
261 0.17
262 0.13
263 0.13
264 0.13
265 0.07
266 0.07
267 0.07
268 0.08
269 0.1
270 0.1
271 0.11
272 0.1
273 0.11
274 0.1
275 0.11
276 0.1
277 0.09
278 0.09
279 0.08
280 0.08
281 0.08
282 0.08
283 0.07
284 0.07
285 0.06
286 0.07
287 0.06
288 0.05
289 0.05
290 0.04
291 0.05
292 0.05
293 0.05
294 0.04
295 0.04
296 0.05
297 0.06
298 0.08
299 0.08
300 0.09
301 0.1
302 0.1
303 0.1
304 0.13
305 0.15
306 0.17
307 0.18
308 0.19
309 0.21
310 0.22
311 0.22
312 0.22
313 0.19
314 0.19
315 0.22
316 0.22
317 0.2
318 0.19
319 0.18
320 0.16
321 0.16
322 0.16
323 0.13
324 0.12
325 0.14
326 0.16
327 0.18
328 0.18
329 0.21
330 0.2
331 0.21
332 0.23
333 0.24
334 0.24
335 0.22
336 0.26
337 0.22
338 0.22
339 0.21
340 0.19
341 0.18
342 0.17
343 0.2
344 0.24
345 0.3
346 0.31
347 0.33
348 0.34
349 0.32
350 0.33
351 0.31
352 0.28
353 0.24
354 0.27
355 0.31
356 0.36
357 0.38
358 0.39
359 0.41
360 0.44
361 0.49
362 0.48
363 0.48
364 0.52
365 0.55
366 0.57
367 0.55
368 0.53
369 0.54
370 0.57
371 0.55
372 0.46
373 0.41
374 0.38
375 0.37
376 0.33
377 0.24
378 0.17
379 0.13
380 0.14
381 0.14
382 0.16
383 0.15
384 0.14
385 0.15
386 0.15
387 0.19
388 0.2
389 0.24
390 0.3
391 0.32
392 0.35
393 0.39
394 0.42
395 0.42
396 0.46
397 0.52
398 0.5
399 0.57
400 0.65
401 0.69
402 0.75
403 0.8