Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QYH4

Protein Details
Accession G2QYH4   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MQASRKKRKVFCSKYISKIFEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG ttt:THITE_33687  -  
Amino Acid Sequences MQASRKKRKVFCSKYISKIFEDFLLREGIIHQRSLANTKELNGFLERINQTLLIRVRAMLIDSRAPKYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.74
4 0.65
5 0.58
6 0.49
7 0.42
8 0.37
9 0.28
10 0.21
11 0.19
12 0.16
13 0.14
14 0.14
15 0.16
16 0.15
17 0.14
18 0.13
19 0.13
20 0.14
21 0.17
22 0.17
23 0.14
24 0.13
25 0.14
26 0.17
27 0.16
28 0.17
29 0.15
30 0.15
31 0.13
32 0.2
33 0.19
34 0.17
35 0.17
36 0.17
37 0.16
38 0.21
39 0.23
40 0.18
41 0.18
42 0.17
43 0.17
44 0.16
45 0.18
46 0.15
47 0.16
48 0.21
49 0.24