Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2RD91

Protein Details
Accession G2RD91    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
88-115DGDEPPPGPHRRKRAKRRDPNNPPEKILBasic
NLS Segment(s)
PositionSequence
94-106PGPHRRKRAKRRD
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
KEGG ttt:THITE_2091431  -  
Amino Acid Sequences MDVTTSDDPSSRGNTPGETPQDPAFACQTPALTDSSSDFDLLSISDLSVSASLDRRNPTVQELESAVTSRRTQKRREGQGSGNAGEEDGDEPPPGPHRRKRAKRRDPNNPPEKILACPFWKADPVLHRDCFSKILTRIRDVKQHLARKQSPKFYCERCSTIFEDDEQRRQHVEDPAGLFCTPSPHLAGLTHRQQALLTRKSNPKLTEEGQWFAVWDIVFPGRPRPRSAYLDARHAAELWAFCEYCRAQGPAVLDEQLRVMVNAGAWTGPEALAGEERREILEWALDQGLEFLFGEWSRSWVAETGKSSAPLADSGGADGGVGPGAQQPRGGSPPGIGGSGSGESVEEGSAGLEEVMEHSEERIRGPSPGSMAGSAAVDSDAVPDLDFSGWLWDNIPRTDTSQGEGELIDLRAGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.35
4 0.38
5 0.35
6 0.36
7 0.34
8 0.37
9 0.34
10 0.33
11 0.29
12 0.24
13 0.24
14 0.22
15 0.21
16 0.18
17 0.19
18 0.19
19 0.15
20 0.15
21 0.16
22 0.18
23 0.18
24 0.16
25 0.14
26 0.12
27 0.12
28 0.11
29 0.11
30 0.08
31 0.07
32 0.07
33 0.07
34 0.08
35 0.08
36 0.08
37 0.09
38 0.12
39 0.14
40 0.19
41 0.22
42 0.25
43 0.27
44 0.28
45 0.3
46 0.32
47 0.3
48 0.28
49 0.27
50 0.26
51 0.23
52 0.23
53 0.2
54 0.18
55 0.2
56 0.27
57 0.35
58 0.4
59 0.46
60 0.55
61 0.64
62 0.72
63 0.77
64 0.74
65 0.71
66 0.74
67 0.72
68 0.63
69 0.53
70 0.42
71 0.34
72 0.27
73 0.22
74 0.14
75 0.09
76 0.09
77 0.08
78 0.08
79 0.1
80 0.17
81 0.23
82 0.29
83 0.35
84 0.46
85 0.57
86 0.67
87 0.78
88 0.82
89 0.87
90 0.9
91 0.94
92 0.94
93 0.95
94 0.95
95 0.93
96 0.85
97 0.76
98 0.7
99 0.61
100 0.53
101 0.45
102 0.39
103 0.31
104 0.3
105 0.28
106 0.24
107 0.25
108 0.22
109 0.23
110 0.25
111 0.3
112 0.34
113 0.34
114 0.34
115 0.34
116 0.34
117 0.33
118 0.28
119 0.27
120 0.26
121 0.33
122 0.34
123 0.38
124 0.44
125 0.44
126 0.5
127 0.48
128 0.52
129 0.53
130 0.58
131 0.58
132 0.6
133 0.65
134 0.67
135 0.69
136 0.69
137 0.63
138 0.59
139 0.62
140 0.58
141 0.57
142 0.52
143 0.5
144 0.43
145 0.44
146 0.43
147 0.39
148 0.34
149 0.29
150 0.32
151 0.3
152 0.34
153 0.3
154 0.29
155 0.26
156 0.27
157 0.29
158 0.26
159 0.25
160 0.23
161 0.24
162 0.23
163 0.23
164 0.22
165 0.18
166 0.13
167 0.14
168 0.11
169 0.1
170 0.1
171 0.09
172 0.1
173 0.11
174 0.14
175 0.17
176 0.21
177 0.23
178 0.22
179 0.22
180 0.21
181 0.27
182 0.32
183 0.33
184 0.3
185 0.33
186 0.39
187 0.42
188 0.47
189 0.42
190 0.37
191 0.36
192 0.35
193 0.36
194 0.32
195 0.31
196 0.27
197 0.25
198 0.22
199 0.17
200 0.17
201 0.1
202 0.07
203 0.07
204 0.07
205 0.08
206 0.08
207 0.16
208 0.19
209 0.21
210 0.24
211 0.28
212 0.34
213 0.38
214 0.43
215 0.45
216 0.42
217 0.47
218 0.46
219 0.41
220 0.36
221 0.31
222 0.26
223 0.17
224 0.15
225 0.09
226 0.1
227 0.08
228 0.08
229 0.11
230 0.11
231 0.12
232 0.14
233 0.14
234 0.12
235 0.15
236 0.17
237 0.14
238 0.15
239 0.14
240 0.12
241 0.11
242 0.11
243 0.1
244 0.08
245 0.07
246 0.07
247 0.06
248 0.06
249 0.06
250 0.06
251 0.05
252 0.05
253 0.06
254 0.05
255 0.05
256 0.05
257 0.05
258 0.05
259 0.08
260 0.09
261 0.09
262 0.09
263 0.1
264 0.1
265 0.11
266 0.11
267 0.08
268 0.09
269 0.09
270 0.1
271 0.09
272 0.09
273 0.08
274 0.08
275 0.07
276 0.06
277 0.06
278 0.05
279 0.06
280 0.06
281 0.09
282 0.08
283 0.1
284 0.1
285 0.1
286 0.1
287 0.13
288 0.15
289 0.17
290 0.19
291 0.21
292 0.22
293 0.23
294 0.22
295 0.2
296 0.18
297 0.14
298 0.13
299 0.11
300 0.1
301 0.1
302 0.1
303 0.09
304 0.08
305 0.07
306 0.06
307 0.04
308 0.04
309 0.04
310 0.07
311 0.09
312 0.09
313 0.1
314 0.11
315 0.14
316 0.17
317 0.19
318 0.16
319 0.15
320 0.19
321 0.19
322 0.19
323 0.15
324 0.12
325 0.13
326 0.13
327 0.12
328 0.08
329 0.07
330 0.07
331 0.08
332 0.07
333 0.05
334 0.04
335 0.05
336 0.05
337 0.05
338 0.04
339 0.04
340 0.04
341 0.05
342 0.06
343 0.06
344 0.06
345 0.07
346 0.12
347 0.12
348 0.14
349 0.16
350 0.16
351 0.17
352 0.19
353 0.21
354 0.2
355 0.23
356 0.24
357 0.21
358 0.2
359 0.19
360 0.18
361 0.15
362 0.12
363 0.08
364 0.07
365 0.06
366 0.07
367 0.07
368 0.07
369 0.07
370 0.07
371 0.08
372 0.08
373 0.08
374 0.07
375 0.12
376 0.13
377 0.13
378 0.14
379 0.17
380 0.2
381 0.22
382 0.24
383 0.2
384 0.23
385 0.28
386 0.28
387 0.27
388 0.27
389 0.26
390 0.25
391 0.23
392 0.2
393 0.18
394 0.17