Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0USE8

Protein Details
Accession Q0USE8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-25GYTWKTAKTRLPPSRQLLHSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 6, mito_nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0000136  C:mannan polymerase complex  
GO:0000032  P:cell wall mannoprotein biosynthetic process  
GO:0006487  P:protein N-linked glycosylation  
KEGG pno:SNOG_05316  -  
Pfam View protein in Pfam  
PF03452  Anp1  
Amino Acid Sequences MLLGKGYTWKTAKTRLPPSRQLLHSLRNPRFLLGFGLFTLFIVLWRSLSPMAGEVQRFSCFGPSKPPMRMSANEAEDWHAHMQTPVIFNHHTPVEINETEVQYVNLNGIDSTIDAVRNKERMLIVTPLKDASKHLATHFDLLVQLTYPHELIDLAFLVGDTSDDTLAILAMELERIQTNPDVAFRSTMIVQKDFGVNIKQEVKDRHKFENQGPRRKAMGRARNYLLATALKPEHSWVYWRDVDIVDSPKSIIEDFIAHDRDVLVPNVWFHRYEKRHGEVFDIEGRFDYNSWQESPQGLALAATLPKSVVLAEGYKQFPTNRKYMALTGDPRANKDEEMPLDGIGGVNIIVKADVHRSGINFPAYAFENQAETEGFAKMAKRAGYGVYGLPNYIVWHVDTEEKPGNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.75
4 0.78
5 0.8
6 0.8
7 0.74
8 0.73
9 0.69
10 0.67
11 0.67
12 0.68
13 0.65
14 0.64
15 0.62
16 0.55
17 0.5
18 0.42
19 0.39
20 0.3
21 0.26
22 0.19
23 0.19
24 0.17
25 0.16
26 0.16
27 0.1
28 0.09
29 0.11
30 0.11
31 0.1
32 0.1
33 0.13
34 0.12
35 0.13
36 0.12
37 0.11
38 0.14
39 0.17
40 0.18
41 0.18
42 0.19
43 0.2
44 0.2
45 0.19
46 0.24
47 0.22
48 0.23
49 0.3
50 0.34
51 0.39
52 0.44
53 0.46
54 0.44
55 0.47
56 0.49
57 0.46
58 0.48
59 0.46
60 0.41
61 0.39
62 0.36
63 0.31
64 0.32
65 0.27
66 0.19
67 0.16
68 0.15
69 0.15
70 0.16
71 0.18
72 0.15
73 0.17
74 0.18
75 0.18
76 0.21
77 0.2
78 0.17
79 0.15
80 0.17
81 0.2
82 0.19
83 0.21
84 0.2
85 0.2
86 0.2
87 0.2
88 0.18
89 0.12
90 0.12
91 0.11
92 0.08
93 0.08
94 0.06
95 0.06
96 0.06
97 0.06
98 0.07
99 0.07
100 0.08
101 0.09
102 0.12
103 0.15
104 0.16
105 0.16
106 0.19
107 0.19
108 0.19
109 0.21
110 0.25
111 0.25
112 0.25
113 0.25
114 0.23
115 0.23
116 0.22
117 0.2
118 0.19
119 0.2
120 0.2
121 0.2
122 0.25
123 0.26
124 0.28
125 0.26
126 0.21
127 0.17
128 0.16
129 0.15
130 0.09
131 0.09
132 0.07
133 0.07
134 0.07
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.05
142 0.05
143 0.04
144 0.04
145 0.04
146 0.04
147 0.03
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.04
162 0.04
163 0.05
164 0.06
165 0.06
166 0.07
167 0.09
168 0.1
169 0.1
170 0.11
171 0.1
172 0.11
173 0.12
174 0.15
175 0.15
176 0.14
177 0.14
178 0.14
179 0.14
180 0.13
181 0.13
182 0.11
183 0.1
184 0.12
185 0.15
186 0.16
187 0.19
188 0.25
189 0.31
190 0.37
191 0.4
192 0.43
193 0.44
194 0.47
195 0.5
196 0.55
197 0.56
198 0.59
199 0.57
200 0.54
201 0.53
202 0.51
203 0.53
204 0.51
205 0.52
206 0.48
207 0.52
208 0.51
209 0.52
210 0.5
211 0.41
212 0.33
213 0.25
214 0.19
215 0.16
216 0.15
217 0.11
218 0.11
219 0.12
220 0.12
221 0.11
222 0.13
223 0.12
224 0.18
225 0.19
226 0.19
227 0.2
228 0.18
229 0.19
230 0.2
231 0.22
232 0.16
233 0.15
234 0.15
235 0.13
236 0.14
237 0.12
238 0.09
239 0.06
240 0.07
241 0.08
242 0.13
243 0.14
244 0.13
245 0.13
246 0.13
247 0.14
248 0.14
249 0.14
250 0.1
251 0.09
252 0.11
253 0.13
254 0.14
255 0.14
256 0.14
257 0.24
258 0.26
259 0.33
260 0.39
261 0.41
262 0.45
263 0.44
264 0.46
265 0.38
266 0.37
267 0.37
268 0.3
269 0.25
270 0.21
271 0.21
272 0.17
273 0.16
274 0.15
275 0.11
276 0.13
277 0.15
278 0.16
279 0.16
280 0.17
281 0.18
282 0.17
283 0.14
284 0.12
285 0.1
286 0.09
287 0.09
288 0.09
289 0.08
290 0.07
291 0.07
292 0.07
293 0.07
294 0.07
295 0.06
296 0.07
297 0.08
298 0.1
299 0.16
300 0.17
301 0.18
302 0.2
303 0.22
304 0.28
305 0.31
306 0.34
307 0.32
308 0.34
309 0.36
310 0.37
311 0.39
312 0.38
313 0.38
314 0.37
315 0.41
316 0.39
317 0.38
318 0.39
319 0.35
320 0.28
321 0.28
322 0.3
323 0.25
324 0.28
325 0.27
326 0.23
327 0.22
328 0.21
329 0.18
330 0.11
331 0.09
332 0.05
333 0.05
334 0.05
335 0.05
336 0.05
337 0.05
338 0.07
339 0.1
340 0.12
341 0.13
342 0.15
343 0.17
344 0.2
345 0.25
346 0.25
347 0.22
348 0.2
349 0.21
350 0.23
351 0.22
352 0.21
353 0.17
354 0.17
355 0.16
356 0.18
357 0.15
358 0.13
359 0.13
360 0.12
361 0.11
362 0.11
363 0.13
364 0.14
365 0.18
366 0.18
367 0.18
368 0.19
369 0.2
370 0.21
371 0.22
372 0.22
373 0.23
374 0.22
375 0.21
376 0.2
377 0.19
378 0.18
379 0.17
380 0.16
381 0.11
382 0.13
383 0.14
384 0.21
385 0.21
386 0.26