Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QTF5

Protein Details
Accession G2QTF5   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-30RFLPLRTRRVCKKSAKWRDWSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 11.666, cyto_nucl 10.333, mito 8.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG ttt:THITE_113215  -  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MANSGPRDRRFLPLRTRRVCKKSAKWRDWSWGSIARDCPSKGAAKCYNCGGEGHIARNCPKGNSYGGGFNSGYGGGGYGPQKTCYSCGGIGHLSLLQLRRLGPPVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.7
3 0.77
4 0.78
5 0.79
6 0.79
7 0.78
8 0.78
9 0.79
10 0.82
11 0.81
12 0.79
13 0.77
14 0.79
15 0.72
16 0.64
17 0.57
18 0.54
19 0.49
20 0.44
21 0.42
22 0.34
23 0.34
24 0.32
25 0.28
26 0.23
27 0.26
28 0.23
29 0.28
30 0.33
31 0.31
32 0.32
33 0.33
34 0.32
35 0.27
36 0.26
37 0.2
38 0.18
39 0.17
40 0.19
41 0.18
42 0.18
43 0.18
44 0.22
45 0.21
46 0.17
47 0.17
48 0.17
49 0.17
50 0.18
51 0.18
52 0.18
53 0.18
54 0.21
55 0.2
56 0.17
57 0.16
58 0.14
59 0.13
60 0.08
61 0.08
62 0.04
63 0.07
64 0.08
65 0.11
66 0.11
67 0.14
68 0.15
69 0.16
70 0.18
71 0.18
72 0.21
73 0.19
74 0.2
75 0.21
76 0.21
77 0.2
78 0.2
79 0.18
80 0.14
81 0.16
82 0.16
83 0.14
84 0.15
85 0.16
86 0.18