Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QSV2

Protein Details
Accession G2QSV2    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-45ASSARIKKNKKTQQIKFKVRCRRFLYHydrophilic
NLS Segment(s)
PositionSequence
24-30RIKKNKK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ttt:THITE_2169250  -  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEIGDIKKFIEICRRKDASSARIKKNKKTQQIKFKVRCRRFLYTLVLKDSEKAEKLKQSLPPNLQIKDVPKRNKPGKASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.46
3 0.49
4 0.45
5 0.51
6 0.55
7 0.53
8 0.57
9 0.61
10 0.61
11 0.67
12 0.71
13 0.73
14 0.78
15 0.77
16 0.77
17 0.78
18 0.77
19 0.8
20 0.86
21 0.88
22 0.86
23 0.86
24 0.86
25 0.8
26 0.8
27 0.75
28 0.7
29 0.63
30 0.59
31 0.57
32 0.54
33 0.52
34 0.46
35 0.41
36 0.35
37 0.32
38 0.3
39 0.26
40 0.2
41 0.2
42 0.21
43 0.24
44 0.27
45 0.31
46 0.36
47 0.4
48 0.46
49 0.48
50 0.53
51 0.54
52 0.52
53 0.49
54 0.46
55 0.46
56 0.48
57 0.54
58 0.53
59 0.55
60 0.64
61 0.71
62 0.76