Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R1T7

Protein Details
Accession G2R1T7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-23AMKAVHKRHCWECRRRCLVCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG ttt:THITE_2012454  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences RALAMKAVHKRHCWECRRRCLVCDFTEPACRRCSAAGVQCPGYGHVKPTRLKWLSPGRVVARADRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.77
4 0.82
5 0.78
6 0.72
7 0.7
8 0.66
9 0.59
10 0.55
11 0.47
12 0.4
13 0.47
14 0.45
15 0.39
16 0.34
17 0.3
18 0.25
19 0.22
20 0.22
21 0.17
22 0.22
23 0.24
24 0.25
25 0.25
26 0.25
27 0.25
28 0.25
29 0.23
30 0.17
31 0.17
32 0.2
33 0.25
34 0.27
35 0.31
36 0.39
37 0.39
38 0.39
39 0.44
40 0.5
41 0.51
42 0.52
43 0.56
44 0.49
45 0.53
46 0.54
47 0.54