Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2RB20

Protein Details
Accession G2RB20    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
17-42WKIPWRLSPTQKARQRKRLRAVDKVIHydrophilic
77-103KYTMFDRKAKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
83-97RKAKRYRKGIHKLPK
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG ttt:THITE_2130676  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITNALSGGLLWKIPWRLSPTQKARQRKRLRAVDKVIETLSNALAKKGETLKSLERWKAEMPTEAQMLPKDKYTMFDRKAKRYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.12
5 0.13
6 0.14
7 0.18
8 0.23
9 0.3
10 0.37
11 0.47
12 0.52
13 0.6
14 0.68
15 0.75
16 0.78
17 0.81
18 0.85
19 0.84
20 0.86
21 0.86
22 0.84
23 0.83
24 0.79
25 0.76
26 0.67
27 0.59
28 0.49
29 0.38
30 0.32
31 0.24
32 0.18
33 0.13
34 0.11
35 0.1
36 0.1
37 0.1
38 0.12
39 0.14
40 0.15
41 0.13
42 0.16
43 0.19
44 0.24
45 0.29
46 0.29
47 0.27
48 0.27
49 0.28
50 0.28
51 0.26
52 0.23
53 0.21
54 0.21
55 0.21
56 0.19
57 0.19
58 0.18
59 0.19
60 0.17
61 0.17
62 0.16
63 0.15
64 0.19
65 0.23
66 0.3
67 0.32
68 0.4
69 0.45
70 0.54
71 0.63
72 0.68
73 0.71
74 0.72
75 0.77
76 0.8
77 0.84
78 0.84
79 0.85
80 0.85
81 0.88
82 0.87
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79