Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2R2Y8

Protein Details
Accession G2R2Y8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
319-341IKPQVVKEERKGKNKNKGGGNKSBasic
NLS Segment(s)
PositionSequence
325-339KEERKGKNKNKGGGN
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR034215  RBM42_RRM  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
KEGG ttt:THITE_2113503  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12383  RRM_RBM42  
Amino Acid Sequences MSYPGPPGVSKPSHPSLPPRPPVTKPPSFKPAFPPTTVAAPGVSAPVYTAPAPSYPGYGPSATPAIGYFAPPAASPYAANPAVTPIGAGRGGYGQRQPGAYNYPSHSYAQQQPAYYGAAAAGGYPTPPQIRNPFSAPDSAAADYDPEMAAQIAQWQSAYIPRDPDDPANKAPAAGGRNGTGAPAAGEAPAGAGEAAAAAAGGGANASGDGTEKKKTVYREGGGKKWQDDTLLEWDPAHLRLFVGNLAGETTDDSLLKAFSRWKSVQKAKVIRDKRTNKSKGFGFVSFSDPEDFFQAAKEMNGKYIQSHPVVVHKAKTEIKPQVVKEERKGKNKNKGGGNKSGSGMGATGAGSAQAYEPHLGPMVGGGITKPGQKTKGGLKLLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.55
4 0.61
5 0.66
6 0.65
7 0.65
8 0.65
9 0.73
10 0.72
11 0.71
12 0.67
13 0.67
14 0.69
15 0.66
16 0.65
17 0.64
18 0.65
19 0.6
20 0.56
21 0.53
22 0.45
23 0.47
24 0.44
25 0.35
26 0.25
27 0.21
28 0.19
29 0.16
30 0.14
31 0.08
32 0.08
33 0.08
34 0.1
35 0.1
36 0.1
37 0.1
38 0.11
39 0.14
40 0.14
41 0.16
42 0.15
43 0.17
44 0.19
45 0.19
46 0.18
47 0.18
48 0.19
49 0.16
50 0.16
51 0.13
52 0.13
53 0.13
54 0.14
55 0.11
56 0.11
57 0.11
58 0.11
59 0.13
60 0.11
61 0.11
62 0.11
63 0.11
64 0.17
65 0.17
66 0.17
67 0.15
68 0.17
69 0.16
70 0.16
71 0.14
72 0.08
73 0.1
74 0.1
75 0.09
76 0.08
77 0.11
78 0.12
79 0.14
80 0.17
81 0.17
82 0.18
83 0.19
84 0.19
85 0.18
86 0.23
87 0.22
88 0.24
89 0.24
90 0.26
91 0.27
92 0.28
93 0.27
94 0.27
95 0.32
96 0.36
97 0.36
98 0.33
99 0.31
100 0.31
101 0.31
102 0.25
103 0.18
104 0.1
105 0.08
106 0.07
107 0.07
108 0.05
109 0.04
110 0.05
111 0.05
112 0.06
113 0.08
114 0.09
115 0.13
116 0.2
117 0.23
118 0.26
119 0.29
120 0.3
121 0.29
122 0.3
123 0.27
124 0.22
125 0.21
126 0.18
127 0.15
128 0.12
129 0.11
130 0.1
131 0.1
132 0.08
133 0.05
134 0.05
135 0.05
136 0.05
137 0.04
138 0.08
139 0.07
140 0.07
141 0.07
142 0.07
143 0.07
144 0.11
145 0.14
146 0.11
147 0.13
148 0.14
149 0.16
150 0.17
151 0.22
152 0.22
153 0.24
154 0.24
155 0.25
156 0.24
157 0.22
158 0.21
159 0.2
160 0.17
161 0.15
162 0.14
163 0.12
164 0.13
165 0.13
166 0.12
167 0.08
168 0.07
169 0.06
170 0.05
171 0.05
172 0.04
173 0.04
174 0.04
175 0.04
176 0.03
177 0.03
178 0.02
179 0.02
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.01
186 0.01
187 0.02
188 0.02
189 0.01
190 0.01
191 0.01
192 0.02
193 0.02
194 0.02
195 0.03
196 0.04
197 0.06
198 0.08
199 0.09
200 0.1
201 0.14
202 0.17
203 0.23
204 0.28
205 0.29
206 0.37
207 0.41
208 0.45
209 0.48
210 0.48
211 0.42
212 0.38
213 0.36
214 0.28
215 0.24
216 0.22
217 0.22
218 0.22
219 0.2
220 0.18
221 0.18
222 0.18
223 0.18
224 0.15
225 0.09
226 0.08
227 0.08
228 0.09
229 0.08
230 0.08
231 0.07
232 0.06
233 0.06
234 0.06
235 0.05
236 0.05
237 0.06
238 0.06
239 0.06
240 0.06
241 0.06
242 0.07
243 0.07
244 0.08
245 0.13
246 0.14
247 0.21
248 0.24
249 0.31
250 0.4
251 0.48
252 0.54
253 0.58
254 0.65
255 0.65
256 0.72
257 0.72
258 0.71
259 0.74
260 0.76
261 0.76
262 0.78
263 0.79
264 0.72
265 0.72
266 0.67
267 0.64
268 0.59
269 0.51
270 0.44
271 0.38
272 0.38
273 0.33
274 0.3
275 0.25
276 0.21
277 0.2
278 0.18
279 0.17
280 0.13
281 0.13
282 0.13
283 0.11
284 0.11
285 0.15
286 0.13
287 0.15
288 0.17
289 0.17
290 0.18
291 0.23
292 0.27
293 0.24
294 0.25
295 0.24
296 0.29
297 0.34
298 0.34
299 0.33
300 0.3
301 0.35
302 0.39
303 0.42
304 0.44
305 0.45
306 0.51
307 0.54
308 0.53
309 0.58
310 0.61
311 0.62
312 0.63
313 0.66
314 0.66
315 0.7
316 0.79
317 0.78
318 0.8
319 0.83
320 0.82
321 0.81
322 0.83
323 0.8
324 0.79
325 0.75
326 0.67
327 0.6
328 0.53
329 0.43
330 0.34
331 0.27
332 0.17
333 0.13
334 0.09
335 0.08
336 0.06
337 0.06
338 0.06
339 0.06
340 0.06
341 0.07
342 0.09
343 0.1
344 0.11
345 0.12
346 0.13
347 0.13
348 0.12
349 0.11
350 0.1
351 0.09
352 0.09
353 0.07
354 0.1
355 0.12
356 0.16
357 0.19
358 0.23
359 0.26
360 0.28
361 0.34
362 0.39
363 0.47