Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2RHV9

Protein Details
Accession G2RHV9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-68HYATLKPEQKVKKDKKAPAKKBasic
NLS Segment(s)
PositionSequence
56-68QKVKKDKKAPAKK
Subcellular Location(s) cyto 7.5, cyto_nucl 5.5, extr 5, mito 4, plas 4, E.R. 3, nucl 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ttt:THITE_2123753  -  
Amino Acid Sequences MGQFDWFAKIGATPQAVATLNDQPILFTILLIVLFSLIAQCVLLWYIHYATLKPEQKVKKDKKAPAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.16
4 0.16
5 0.17
6 0.18
7 0.17
8 0.18
9 0.18
10 0.14
11 0.14
12 0.16
13 0.12
14 0.08
15 0.07
16 0.06
17 0.06
18 0.06
19 0.05
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.03
31 0.04
32 0.05
33 0.06
34 0.09
35 0.09
36 0.09
37 0.12
38 0.22
39 0.26
40 0.27
41 0.35
42 0.4
43 0.49
44 0.6
45 0.66
46 0.68
47 0.73
48 0.81