Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UN92

Protein Details
Accession Q0UN92   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
111-139VDPPKEKKEKVEDKPKPEHKHNPNKSRKRBasic
NLS Segment(s)
PositionSequence
114-139PKEKKEKVEDKPKPEHKHNPNKSRKR
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
KEGG pno:SNOG_06772  -  
Amino Acid Sequences MPRGSPENHIKEFIESIPDSKLTGTFGSPGANVFSDTGYRLDMQNYTSDDDNKEAGIRFNLQVQVNFGNPKRSVQKLAPGSVAWILLPVDDTWTPKMIRDELLKSVTGYRVDPPKEKKEKVEDKPKPEHKHNPNKSRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.23
3 0.22
4 0.21
5 0.21
6 0.19
7 0.17
8 0.17
9 0.13
10 0.13
11 0.12
12 0.12
13 0.12
14 0.13
15 0.12
16 0.12
17 0.12
18 0.11
19 0.11
20 0.1
21 0.1
22 0.09
23 0.1
24 0.1
25 0.1
26 0.1
27 0.1
28 0.11
29 0.11
30 0.11
31 0.14
32 0.14
33 0.15
34 0.16
35 0.17
36 0.16
37 0.17
38 0.16
39 0.13
40 0.13
41 0.12
42 0.11
43 0.11
44 0.12
45 0.11
46 0.12
47 0.16
48 0.16
49 0.15
50 0.16
51 0.16
52 0.16
53 0.18
54 0.17
55 0.17
56 0.17
57 0.19
58 0.21
59 0.22
60 0.24
61 0.23
62 0.3
63 0.29
64 0.31
65 0.29
66 0.25
67 0.24
68 0.21
69 0.2
70 0.11
71 0.08
72 0.06
73 0.05
74 0.06
75 0.05
76 0.07
77 0.07
78 0.09
79 0.1
80 0.13
81 0.13
82 0.15
83 0.18
84 0.17
85 0.2
86 0.23
87 0.25
88 0.26
89 0.28
90 0.26
91 0.24
92 0.25
93 0.24
94 0.21
95 0.19
96 0.2
97 0.26
98 0.3
99 0.36
100 0.42
101 0.49
102 0.57
103 0.6
104 0.62
105 0.66
106 0.72
107 0.75
108 0.79
109 0.77
110 0.77
111 0.84
112 0.87
113 0.84
114 0.83
115 0.84
116 0.84
117 0.86
118 0.88
119 0.89