Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R212

Protein Details
Accession C4R212   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
125-147ITSAKTKPTLKKRKLDNSSRGNIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019331  FAM192A/Fyv6_N  
Gene Ontology GO:0005634  C:nucleus  
KEGG ppa:PAS_chr2-2_0369  -  
Pfam View protein in Pfam  
PF10187  FAM192A_Fyv6_N  
Amino Acid Sequences MSNRFVQAGQIDSETFQKQIERENEESAKHAEEQRQREGKTLVQQLEKHKLEKYQEYQQQLEHTNSAYRLNEKDSTFYNELQRKQKEQESIKARFLGQRVEEYRKLKDMGPNLNAMQHLKVSSLITSAKTKPTLKKRKLDNSSRGNIVGYSSSDDDEDEKAHEDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.16
4 0.17
5 0.16
6 0.24
7 0.3
8 0.33
9 0.35
10 0.41
11 0.42
12 0.4
13 0.42
14 0.36
15 0.32
16 0.27
17 0.29
18 0.3
19 0.35
20 0.39
21 0.46
22 0.51
23 0.49
24 0.51
25 0.49
26 0.45
27 0.46
28 0.47
29 0.42
30 0.4
31 0.44
32 0.46
33 0.53
34 0.51
35 0.45
36 0.4
37 0.4
38 0.4
39 0.43
40 0.42
41 0.42
42 0.45
43 0.48
44 0.47
45 0.44
46 0.43
47 0.38
48 0.34
49 0.26
50 0.21
51 0.18
52 0.18
53 0.18
54 0.15
55 0.15
56 0.15
57 0.17
58 0.21
59 0.2
60 0.21
61 0.2
62 0.25
63 0.25
64 0.26
65 0.3
66 0.3
67 0.35
68 0.41
69 0.42
70 0.38
71 0.4
72 0.42
73 0.43
74 0.41
75 0.45
76 0.45
77 0.46
78 0.45
79 0.43
80 0.4
81 0.35
82 0.33
83 0.28
84 0.22
85 0.25
86 0.26
87 0.31
88 0.35
89 0.35
90 0.36
91 0.34
92 0.35
93 0.31
94 0.32
95 0.32
96 0.34
97 0.33
98 0.34
99 0.31
100 0.31
101 0.3
102 0.26
103 0.21
104 0.15
105 0.13
106 0.11
107 0.12
108 0.11
109 0.1
110 0.11
111 0.12
112 0.13
113 0.17
114 0.19
115 0.22
116 0.27
117 0.32
118 0.39
119 0.49
120 0.58
121 0.62
122 0.69
123 0.74
124 0.8
125 0.85
126 0.86
127 0.85
128 0.83
129 0.8
130 0.75
131 0.65
132 0.55
133 0.45
134 0.37
135 0.29
136 0.21
137 0.19
138 0.17
139 0.17
140 0.16
141 0.17
142 0.17
143 0.16
144 0.16
145 0.13