Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QV51

Protein Details
Accession G2QV51    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
259-291GSTVQARSPRCRRVEKRRKKENKTTGKGNNDLAHydrophilic
NLS Segment(s)
PositionSequence
270-281RRVEKRRKKENK
Subcellular Location(s) extr 18, plas 5, E.R. 2
Family & Domain DBs
KEGG ttt:THITE_2038768  -  
Amino Acid Sequences MTRFLLLLATCITCVLPGPQLASQPTAPTVAYLPTFPGAHGMPPVPVLCPRCPQYTPGACVVPPVPALYPRCPRCGPGARVLPPVPMLWPWGPRSNPGARGMPPVPALWPWCPRCGPGAHGMPPVPTLWPWCPPLWPWCPRYGRGARVLPPVPVFYPRCPRYAPGAYVLPPVPTVCPRCPRYAPGARVVPPVPTVCPRCPRCGRGTRVVALVPTLCPWCRPRYALRTAPPVAHLAAAPPDAYLPTAGPVAQAPAYSSPGSTVQARSPRCRRVEKRRKKENKTTGKGNNDLAVSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.12
5 0.15
6 0.16
7 0.2
8 0.22
9 0.24
10 0.23
11 0.22
12 0.22
13 0.2
14 0.18
15 0.16
16 0.15
17 0.14
18 0.14
19 0.13
20 0.14
21 0.15
22 0.15
23 0.14
24 0.16
25 0.14
26 0.14
27 0.16
28 0.15
29 0.13
30 0.15
31 0.15
32 0.13
33 0.18
34 0.21
35 0.22
36 0.27
37 0.31
38 0.34
39 0.35
40 0.36
41 0.42
42 0.44
43 0.44
44 0.42
45 0.4
46 0.34
47 0.35
48 0.33
49 0.25
50 0.18
51 0.16
52 0.13
53 0.16
54 0.21
55 0.26
56 0.34
57 0.35
58 0.41
59 0.41
60 0.42
61 0.46
62 0.51
63 0.48
64 0.48
65 0.53
66 0.5
67 0.55
68 0.53
69 0.45
70 0.37
71 0.33
72 0.25
73 0.17
74 0.18
75 0.15
76 0.18
77 0.2
78 0.25
79 0.25
80 0.27
81 0.32
82 0.33
83 0.35
84 0.35
85 0.35
86 0.3
87 0.36
88 0.34
89 0.3
90 0.27
91 0.23
92 0.2
93 0.17
94 0.19
95 0.17
96 0.24
97 0.23
98 0.26
99 0.26
100 0.26
101 0.28
102 0.26
103 0.25
104 0.25
105 0.27
106 0.27
107 0.28
108 0.28
109 0.25
110 0.24
111 0.22
112 0.15
113 0.11
114 0.11
115 0.11
116 0.14
117 0.16
118 0.16
119 0.16
120 0.18
121 0.24
122 0.27
123 0.31
124 0.3
125 0.35
126 0.38
127 0.38
128 0.45
129 0.43
130 0.4
131 0.42
132 0.43
133 0.38
134 0.41
135 0.4
136 0.33
137 0.29
138 0.26
139 0.2
140 0.22
141 0.21
142 0.19
143 0.28
144 0.29
145 0.3
146 0.3
147 0.31
148 0.34
149 0.35
150 0.33
151 0.27
152 0.27
153 0.26
154 0.27
155 0.26
156 0.19
157 0.15
158 0.14
159 0.11
160 0.13
161 0.17
162 0.19
163 0.27
164 0.3
165 0.35
166 0.36
167 0.38
168 0.43
169 0.47
170 0.46
171 0.44
172 0.46
173 0.43
174 0.44
175 0.42
176 0.34
177 0.27
178 0.25
179 0.2
180 0.21
181 0.24
182 0.26
183 0.35
184 0.37
185 0.44
186 0.49
187 0.52
188 0.55
189 0.6
190 0.61
191 0.61
192 0.63
193 0.56
194 0.52
195 0.48
196 0.39
197 0.31
198 0.25
199 0.16
200 0.13
201 0.13
202 0.11
203 0.14
204 0.17
205 0.21
206 0.24
207 0.27
208 0.34
209 0.4
210 0.48
211 0.53
212 0.55
213 0.59
214 0.57
215 0.54
216 0.48
217 0.41
218 0.33
219 0.26
220 0.2
221 0.13
222 0.13
223 0.13
224 0.11
225 0.09
226 0.09
227 0.08
228 0.09
229 0.08
230 0.07
231 0.07
232 0.08
233 0.08
234 0.08
235 0.08
236 0.1
237 0.1
238 0.1
239 0.1
240 0.12
241 0.15
242 0.15
243 0.14
244 0.14
245 0.16
246 0.18
247 0.19
248 0.19
249 0.23
250 0.31
251 0.36
252 0.44
253 0.51
254 0.57
255 0.62
256 0.71
257 0.74
258 0.78
259 0.85
260 0.86
261 0.89
262 0.92
263 0.95
264 0.94
265 0.95
266 0.95
267 0.95
268 0.92
269 0.91
270 0.89
271 0.87
272 0.82
273 0.74
274 0.67