Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2R104

Protein Details
Accession G2R104    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-83CDAPRTGRPSKRKVNQDADAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 9.5, mito 6, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013249  RNA_pol_sigma70_r4_t2  
Gene Ontology GO:0003677  F:DNA binding  
GO:0016987  F:sigma factor activity  
GO:0006352  P:DNA-templated transcription initiation  
KEGG ttt:THITE_2114632  -  
Pfam View protein in Pfam  
PF08281  Sigma70_r4_2  
Amino Acid Sequences MPHYDIATRAQALTLKLILQLSNAEIEELTGLSSRTVNSIATKALERGFDPNARPVLILDKHVCDAPRTGRPSKRKVNQDADAAQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.15
4 0.15
5 0.14
6 0.12
7 0.12
8 0.1
9 0.11
10 0.1
11 0.08
12 0.07
13 0.07
14 0.07
15 0.06
16 0.06
17 0.05
18 0.05
19 0.05
20 0.06
21 0.06
22 0.06
23 0.07
24 0.07
25 0.08
26 0.09
27 0.09
28 0.09
29 0.1
30 0.1
31 0.11
32 0.11
33 0.1
34 0.12
35 0.14
36 0.16
37 0.17
38 0.2
39 0.19
40 0.19
41 0.19
42 0.16
43 0.2
44 0.19
45 0.21
46 0.19
47 0.2
48 0.21
49 0.22
50 0.22
51 0.17
52 0.2
53 0.22
54 0.28
55 0.33
56 0.39
57 0.47
58 0.55
59 0.63
60 0.7
61 0.73
62 0.76
63 0.79
64 0.81
65 0.78
66 0.77