Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2RA10

Protein Details
Accession G2RA10   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
164-195QTQIRRFNMKKPKACSRRRRRVKSYADNVPRLHydrophilic
NLS Segment(s)
PositionSequence
173-187KKPKACSRRRRRVKS
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7, cyto 2.5
Family & Domain DBs
KEGG ttt:THITE_2118449  -  
Amino Acid Sequences MPPTTSAGLPAMAKQSTPKTMSSRLMTMKFMQRGAAAAAAAASASGTPVASSPASPRSEDGSAKRRKFAHTPSSAAGSPATPLFDQKAIQAAMEEEEKKRQAAIEKRAAELGDSHWVLEGASALPAGGSRPLLNVVQVGFSQIDYAGVSTGDDDPFDMGSVPAQTQIRRFNMKKPKACSRRRRRVKSYADNVPRLLRKRMMRPPAVALIPALAQMPKVTLKTRAPLRHLETSRAAAGTLLPM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.29
4 0.31
5 0.33
6 0.35
7 0.41
8 0.47
9 0.46
10 0.47
11 0.48
12 0.48
13 0.46
14 0.46
15 0.48
16 0.44
17 0.41
18 0.36
19 0.3
20 0.28
21 0.26
22 0.22
23 0.13
24 0.1
25 0.09
26 0.08
27 0.07
28 0.05
29 0.04
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.06
37 0.07
38 0.07
39 0.1
40 0.17
41 0.18
42 0.19
43 0.2
44 0.22
45 0.25
46 0.29
47 0.32
48 0.36
49 0.44
50 0.45
51 0.49
52 0.48
53 0.49
54 0.53
55 0.55
56 0.55
57 0.51
58 0.53
59 0.49
60 0.5
61 0.46
62 0.39
63 0.3
64 0.2
65 0.16
66 0.12
67 0.12
68 0.08
69 0.09
70 0.1
71 0.11
72 0.11
73 0.1
74 0.14
75 0.13
76 0.12
77 0.12
78 0.1
79 0.1
80 0.13
81 0.13
82 0.1
83 0.14
84 0.15
85 0.14
86 0.14
87 0.14
88 0.2
89 0.26
90 0.33
91 0.38
92 0.39
93 0.39
94 0.4
95 0.38
96 0.31
97 0.24
98 0.17
99 0.13
100 0.12
101 0.11
102 0.1
103 0.1
104 0.1
105 0.09
106 0.08
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.04
118 0.06
119 0.06
120 0.07
121 0.07
122 0.07
123 0.07
124 0.07
125 0.08
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.05
132 0.05
133 0.04
134 0.04
135 0.04
136 0.05
137 0.06
138 0.06
139 0.05
140 0.06
141 0.06
142 0.06
143 0.06
144 0.05
145 0.04
146 0.05
147 0.06
148 0.06
149 0.09
150 0.1
151 0.11
152 0.15
153 0.22
154 0.26
155 0.33
156 0.35
157 0.41
158 0.51
159 0.59
160 0.63
161 0.64
162 0.7
163 0.72
164 0.81
165 0.83
166 0.83
167 0.85
168 0.89
169 0.93
170 0.91
171 0.91
172 0.91
173 0.91
174 0.88
175 0.87
176 0.84
177 0.77
178 0.7
179 0.66
180 0.62
181 0.55
182 0.52
183 0.48
184 0.47
185 0.53
186 0.61
187 0.63
188 0.62
189 0.61
190 0.61
191 0.6
192 0.54
193 0.44
194 0.35
195 0.26
196 0.21
197 0.18
198 0.14
199 0.08
200 0.08
201 0.07
202 0.1
203 0.12
204 0.14
205 0.16
206 0.22
207 0.26
208 0.34
209 0.44
210 0.49
211 0.51
212 0.57
213 0.62
214 0.65
215 0.64
216 0.61
217 0.57
218 0.53
219 0.5
220 0.42
221 0.35
222 0.25