Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2QYH5

Protein Details
Accession G2QYH5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-71KAKAATPTKKSKKAKKAKKEESEEEDBasic
NLS Segment(s)
PositionSequence
39-64AKGKGKGKAKAATPTKKSKKAKKAKK
Subcellular Location(s) cyto 11.5, cyto_nucl 9.5, nucl 6.5, E.R. 4, vacu 3
Family & Domain DBs
KEGG ttt:THITE_110108  -  
Amino Acid Sequences MCIERGAPLKLVFNYIRKGEDANAKNNDDDNNEYTPIPAKGKGKGKAKAATPTKKSKKAKKAKKEESEEEDKDKDESKEEAALGFDLEALACSIVVAILAAITSKKKKGSIGTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.32
4 0.28
5 0.29
6 0.28
7 0.34
8 0.34
9 0.37
10 0.4
11 0.4
12 0.4
13 0.4
14 0.37
15 0.3
16 0.3
17 0.26
18 0.23
19 0.23
20 0.22
21 0.2
22 0.21
23 0.2
24 0.18
25 0.19
26 0.18
27 0.24
28 0.31
29 0.38
30 0.44
31 0.47
32 0.51
33 0.51
34 0.52
35 0.54
36 0.55
37 0.56
38 0.54
39 0.59
40 0.61
41 0.66
42 0.71
43 0.72
44 0.74
45 0.77
46 0.82
47 0.82
48 0.86
49 0.87
50 0.88
51 0.86
52 0.81
53 0.78
54 0.75
55 0.67
56 0.6
57 0.5
58 0.41
59 0.35
60 0.32
61 0.25
62 0.19
63 0.18
64 0.16
65 0.17
66 0.16
67 0.16
68 0.13
69 0.13
70 0.1
71 0.09
72 0.07
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.02
85 0.02
86 0.02
87 0.03
88 0.04
89 0.09
90 0.13
91 0.17
92 0.21
93 0.24
94 0.29