Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R9X4

Protein Details
Accession G2R9X4   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-74NMSQEKGKMKNGHKNFKKKNIIKKRKKQYSELGRSAPNRSKTPKQTQKGKQRKKARRIMDNKSHNDHydrophilic
NLS Segment(s)
PositionSequence
14-65KGKMKNGHKNFKKKNIIKKRKKQYSELGRSAPNRSKTPKQTQKGKQRKKARR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
KEGG ttt:THITE_127149  -  
Amino Acid Sequences MMMIPDPYNMSQEKGKMKNGHKNFKKKNIIKKRKKQYSELGRSAPNRSKTPKQTQKGKQRKKARRIMDNKSHNDNNCHRPQQAHSPDPKINSQSPVTSSGLERGEAGPLTRQRRRYAQHASCPQNHVLQKEKIRFDSSRIEPYGRKPKETTNTDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.44
3 0.49
4 0.56
5 0.64
6 0.7
7 0.75
8 0.76
9 0.82
10 0.84
11 0.86
12 0.89
13 0.86
14 0.88
15 0.88
16 0.9
17 0.9
18 0.91
19 0.92
20 0.92
21 0.89
22 0.86
23 0.85
24 0.85
25 0.83
26 0.79
27 0.71
28 0.66
29 0.63
30 0.62
31 0.58
32 0.52
33 0.47
34 0.48
35 0.53
36 0.56
37 0.64
38 0.68
39 0.69
40 0.74
41 0.79
42 0.84
43 0.86
44 0.88
45 0.86
46 0.87
47 0.89
48 0.89
49 0.88
50 0.85
51 0.84
52 0.83
53 0.82
54 0.81
55 0.8
56 0.74
57 0.72
58 0.67
59 0.58
60 0.56
61 0.52
62 0.5
63 0.47
64 0.45
65 0.39
66 0.37
67 0.38
68 0.42
69 0.43
70 0.42
71 0.4
72 0.42
73 0.44
74 0.45
75 0.44
76 0.38
77 0.33
78 0.3
79 0.27
80 0.23
81 0.23
82 0.25
83 0.23
84 0.2
85 0.19
86 0.19
87 0.19
88 0.17
89 0.16
90 0.12
91 0.13
92 0.12
93 0.12
94 0.13
95 0.19
96 0.26
97 0.3
98 0.34
99 0.38
100 0.46
101 0.5
102 0.53
103 0.58
104 0.59
105 0.64
106 0.7
107 0.72
108 0.69
109 0.68
110 0.61
111 0.58
112 0.52
113 0.46
114 0.44
115 0.45
116 0.49
117 0.52
118 0.55
119 0.51
120 0.54
121 0.51
122 0.49
123 0.51
124 0.48
125 0.48
126 0.46
127 0.47
128 0.44
129 0.53
130 0.59
131 0.53
132 0.53
133 0.48
134 0.55
135 0.61