Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R719

Protein Details
Accession G2R719   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
97-117QDEATKRKRHVITKSKPEGSHBasic
NLS Segment(s)
Subcellular Location(s) extr 14, plas 6, mito 4, golg 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ttt:THITE_2116742  -  
Amino Acid Sequences MAWGTQHTQTPPSPVKQLLPLIITLVILSVVAWVGYQIYLSMVKIQAQARRQMGDNVVFTKAGVRVQVQDLGTESYVDKTQSWVVKAWNLGSASNAQDEATKRKRHVITKSKPEGSHHHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.38
4 0.4
5 0.34
6 0.3
7 0.26
8 0.23
9 0.21
10 0.18
11 0.12
12 0.09
13 0.06
14 0.05
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.04
26 0.05
27 0.05
28 0.07
29 0.07
30 0.09
31 0.13
32 0.15
33 0.19
34 0.21
35 0.27
36 0.26
37 0.27
38 0.27
39 0.25
40 0.25
41 0.23
42 0.22
43 0.18
44 0.17
45 0.15
46 0.14
47 0.13
48 0.12
49 0.09
50 0.09
51 0.08
52 0.09
53 0.1
54 0.14
55 0.13
56 0.12
57 0.12
58 0.13
59 0.12
60 0.11
61 0.1
62 0.08
63 0.09
64 0.1
65 0.09
66 0.09
67 0.13
68 0.15
69 0.17
70 0.17
71 0.18
72 0.2
73 0.21
74 0.2
75 0.2
76 0.19
77 0.17
78 0.17
79 0.18
80 0.16
81 0.16
82 0.15
83 0.11
84 0.14
85 0.17
86 0.25
87 0.31
88 0.35
89 0.36
90 0.45
91 0.52
92 0.57
93 0.65
94 0.67
95 0.69
96 0.75
97 0.83
98 0.82
99 0.77
100 0.74