Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QUV4

Protein Details
Accession G2QUV4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-74RVSKQLRGRQLRSHRRRPGPHALVBasic
NLS Segment(s)
PositionSequence
51-68RVSKQLRGRQLRSHRRRP
Subcellular Location(s) extr 18, mito 3, cyto 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ttt:THITE_2109340  -  
Amino Acid Sequences MPLPRPSPAAPGTLGVTRGIALGVLAALVFLLLAVIGLSAGLHGRVYRRVRVSKQLRGRQLRSHRRRPGPHALVLDEDEPDKVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.17
3 0.15
4 0.13
5 0.12
6 0.1
7 0.07
8 0.05
9 0.04
10 0.03
11 0.03
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.01
18 0.01
19 0.01
20 0.01
21 0.01
22 0.01
23 0.01
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.04
32 0.12
33 0.14
34 0.19
35 0.25
36 0.3
37 0.34
38 0.44
39 0.5
40 0.53
41 0.61
42 0.64
43 0.68
44 0.71
45 0.72
46 0.71
47 0.75
48 0.77
49 0.77
50 0.8
51 0.8
52 0.82
53 0.85
54 0.84
55 0.84
56 0.79
57 0.76
58 0.69
59 0.6
60 0.53
61 0.48
62 0.4
63 0.3
64 0.25