Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2RBL7

Protein Details
Accession G2RBL7    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-32SSQHNQSRKAHRNGIKRPKTQRYPSLHydrophilic
NLS Segment(s)
PositionSequence
14-61RKAHRNGIKRPKTQRYPSLKGTDPKFRRNHRHALHGTAKALKEFREGK
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ttt:THITE_2170947  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSRKAHRNGIKRPKTQRYPSLKGTDPKFRRNHRHALHGTAKALKEFREGKRETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.79
4 0.77
5 0.78
6 0.8
7 0.83
8 0.81
9 0.8
10 0.82
11 0.82
12 0.84
13 0.81
14 0.8
15 0.78
16 0.74
17 0.72
18 0.68
19 0.62
20 0.58
21 0.55
22 0.56
23 0.51
24 0.53
25 0.56
26 0.59
27 0.65
28 0.66
29 0.72
30 0.66
31 0.71
32 0.65
33 0.66
34 0.64
35 0.57
36 0.54
37 0.48
38 0.45
39 0.39
40 0.38
41 0.3
42 0.31
43 0.34
44 0.38
45 0.43