Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R1R5

Protein Details
Accession G2R1R5    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
73-94GPRVQWSLGVRQKKKRKKVRARBasic
NLS Segment(s)
PositionSequence
83-94RQKKKRKKVRAR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG ttt:THITE_2111263  -  
Amino Acid Sequences MKKKLDGSRVRNAEETNARGPINRPVPPLSVSSAPEFPVPHPFWSCIGRLREREGEENNQCSQPDSLNPPPPGPRVQWSLGVRQKKKRKKVRAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.46
3 0.39
4 0.36
5 0.33
6 0.31
7 0.32
8 0.33
9 0.33
10 0.32
11 0.32
12 0.31
13 0.34
14 0.34
15 0.34
16 0.28
17 0.24
18 0.23
19 0.23
20 0.21
21 0.19
22 0.19
23 0.18
24 0.16
25 0.21
26 0.21
27 0.2
28 0.21
29 0.21
30 0.22
31 0.23
32 0.23
33 0.21
34 0.24
35 0.26
36 0.26
37 0.29
38 0.32
39 0.32
40 0.35
41 0.33
42 0.37
43 0.36
44 0.38
45 0.35
46 0.32
47 0.29
48 0.27
49 0.24
50 0.17
51 0.17
52 0.21
53 0.26
54 0.33
55 0.34
56 0.35
57 0.37
58 0.39
59 0.4
60 0.35
61 0.34
62 0.32
63 0.33
64 0.39
65 0.38
66 0.45
67 0.49
68 0.57
69 0.59
70 0.64
71 0.73
72 0.75
73 0.83
74 0.84