Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2RCD9

Protein Details
Accession G2RCD9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MMPRCQRCPRCQRYSHNAAVPHydrophilic
67-88AMMPRCQRCPRCQRYSHNATVPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
KEGG ttt:THITE_2122206  -  
Amino Acid Sequences MMPRCQRCPRCQRYSHNAAVPAIPAMPTMPAMPTMPAMPAMPAVPAIQPQCRDARDARDARSASDTAMMPRCQRCPRCQRYSHNATVPAIQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.81
3 0.75
4 0.68
5 0.59
6 0.51
7 0.42
8 0.32
9 0.24
10 0.16
11 0.11
12 0.07
13 0.07
14 0.07
15 0.06
16 0.06
17 0.07
18 0.07
19 0.08
20 0.08
21 0.08
22 0.07
23 0.08
24 0.07
25 0.06
26 0.07
27 0.06
28 0.05
29 0.06
30 0.06
31 0.05
32 0.07
33 0.09
34 0.1
35 0.11
36 0.13
37 0.16
38 0.16
39 0.19
40 0.19
41 0.23
42 0.3
43 0.32
44 0.33
45 0.37
46 0.37
47 0.36
48 0.37
49 0.32
50 0.23
51 0.23
52 0.21
53 0.17
54 0.22
55 0.22
56 0.23
57 0.26
58 0.33
59 0.39
60 0.44
61 0.51
62 0.57
63 0.66
64 0.71
65 0.77
66 0.8
67 0.81
68 0.85
69 0.83
70 0.79
71 0.73
72 0.65