Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R9I3

Protein Details
Accession G2R9I3   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSSRASTIKKNNQRLKKNVFGPHydrophilic
74-106VDGAKPASKKPNSKRKRVEKRRGKKSSIVFPTRBasic
NLS Segment(s)
PositionSequence
78-113KPASKKPNSKRKRVEKRRGKKSSIVFPTRGPKRNKK
Subcellular Location(s) nucl 15, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG ttt:THITE_2120041  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRASTIKKNNQRLKKNVFGPVEAARAERLSAKLLALAAQPKPQRDVEMNEAPTDESKDTATEKMDTAMDVDGAKPASKKPNSKRKRVEKRRGKKSSIVFPTRGPKRNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.87
4 0.84
5 0.83
6 0.78
7 0.76
8 0.69
9 0.6
10 0.54
11 0.47
12 0.41
13 0.33
14 0.27
15 0.2
16 0.17
17 0.17
18 0.15
19 0.13
20 0.13
21 0.13
22 0.12
23 0.12
24 0.11
25 0.12
26 0.11
27 0.13
28 0.12
29 0.17
30 0.19
31 0.19
32 0.22
33 0.21
34 0.22
35 0.22
36 0.25
37 0.26
38 0.3
39 0.3
40 0.27
41 0.27
42 0.25
43 0.22
44 0.2
45 0.13
46 0.07
47 0.07
48 0.08
49 0.09
50 0.1
51 0.11
52 0.1
53 0.1
54 0.11
55 0.11
56 0.1
57 0.1
58 0.09
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.11
67 0.2
68 0.26
69 0.36
70 0.45
71 0.56
72 0.63
73 0.73
74 0.8
75 0.82
76 0.88
77 0.9
78 0.91
79 0.91
80 0.94
81 0.95
82 0.94
83 0.88
84 0.85
85 0.82
86 0.82
87 0.81
88 0.76
89 0.68
90 0.65
91 0.69
92 0.7
93 0.7