Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QZ72

Protein Details
Accession G2QZ72    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
77-99ANTSRRRAPLPSRRRRTPSPYIEHydrophilic
338-364LPPSPIPKYVRERRRTGRRSPVDDEPDHydrophilic
NLS Segment(s)
PositionSequence
85-91PLPSRRR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
KEGG ttt:THITE_152194  -  
Amino Acid Sequences MSSSGNGGYGGSSYLGAGYGSSASNPYGSSSQGHGSGTTSGVGTSTYTTGTSAATPSQDNTTTTAATASASSSRYQANTSRRRAPLPSRRRRTPSPYIEQAPGESDNGNDSDNGSDSDNGSNSDNGSESDNGSNSDGPPLVQDTDYSYLTAADVDAADLQRWSSMTPADQPAGPGQLPDWLLPHGQRLASSHHSSDWTTSGEAEQTTGDVQHGYNYPYGGGSAWHGYASPYSYGQANPFSSGHANPPYSYGQANPFSSGQTNPSYSYGHANPSYSYGYANPYSYGQANPYSHGQANPSYNYGHAGPSNSNSGHGGDRGAPEMNSGGEESWNTTVFSHLPPSPIPKYVRERRRTGRRSPVDDEPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.06
5 0.06
6 0.07
7 0.07
8 0.07
9 0.09
10 0.09
11 0.1
12 0.1
13 0.12
14 0.12
15 0.13
16 0.15
17 0.17
18 0.19
19 0.2
20 0.21
21 0.18
22 0.18
23 0.18
24 0.17
25 0.15
26 0.12
27 0.1
28 0.09
29 0.09
30 0.08
31 0.08
32 0.08
33 0.08
34 0.09
35 0.09
36 0.1
37 0.1
38 0.1
39 0.1
40 0.11
41 0.12
42 0.13
43 0.14
44 0.17
45 0.18
46 0.18
47 0.2
48 0.21
49 0.19
50 0.18
51 0.17
52 0.13
53 0.12
54 0.11
55 0.09
56 0.1
57 0.11
58 0.11
59 0.13
60 0.15
61 0.15
62 0.18
63 0.24
64 0.32
65 0.4
66 0.46
67 0.53
68 0.55
69 0.57
70 0.61
71 0.65
72 0.65
73 0.67
74 0.72
75 0.72
76 0.78
77 0.81
78 0.83
79 0.81
80 0.8
81 0.78
82 0.76
83 0.74
84 0.69
85 0.64
86 0.57
87 0.49
88 0.41
89 0.32
90 0.25
91 0.17
92 0.14
93 0.12
94 0.12
95 0.12
96 0.09
97 0.09
98 0.08
99 0.09
100 0.1
101 0.09
102 0.09
103 0.1
104 0.12
105 0.11
106 0.12
107 0.12
108 0.11
109 0.11
110 0.11
111 0.1
112 0.09
113 0.11
114 0.1
115 0.11
116 0.12
117 0.12
118 0.12
119 0.13
120 0.13
121 0.11
122 0.12
123 0.1
124 0.09
125 0.09
126 0.1
127 0.1
128 0.09
129 0.09
130 0.1
131 0.13
132 0.13
133 0.13
134 0.11
135 0.1
136 0.1
137 0.1
138 0.07
139 0.04
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.06
152 0.06
153 0.09
154 0.11
155 0.11
156 0.11
157 0.12
158 0.12
159 0.13
160 0.12
161 0.09
162 0.07
163 0.1
164 0.1
165 0.1
166 0.1
167 0.09
168 0.1
169 0.1
170 0.11
171 0.1
172 0.09
173 0.09
174 0.1
175 0.14
176 0.18
177 0.2
178 0.19
179 0.19
180 0.2
181 0.2
182 0.19
183 0.16
184 0.13
185 0.11
186 0.11
187 0.1
188 0.09
189 0.09
190 0.08
191 0.07
192 0.06
193 0.06
194 0.06
195 0.05
196 0.05
197 0.05
198 0.07
199 0.08
200 0.1
201 0.1
202 0.1
203 0.1
204 0.09
205 0.1
206 0.07
207 0.06
208 0.06
209 0.07
210 0.07
211 0.07
212 0.07
213 0.07
214 0.08
215 0.09
216 0.08
217 0.08
218 0.08
219 0.1
220 0.1
221 0.12
222 0.15
223 0.14
224 0.15
225 0.15
226 0.16
227 0.17
228 0.17
229 0.2
230 0.21
231 0.21
232 0.19
233 0.22
234 0.22
235 0.21
236 0.21
237 0.18
238 0.19
239 0.23
240 0.23
241 0.22
242 0.21
243 0.21
244 0.22
245 0.21
246 0.19
247 0.17
248 0.18
249 0.18
250 0.19
251 0.19
252 0.19
253 0.24
254 0.22
255 0.24
256 0.24
257 0.23
258 0.22
259 0.23
260 0.24
261 0.19
262 0.18
263 0.14
264 0.18
265 0.18
266 0.19
267 0.17
268 0.16
269 0.18
270 0.18
271 0.18
272 0.16
273 0.2
274 0.2
275 0.22
276 0.24
277 0.26
278 0.26
279 0.26
280 0.26
281 0.25
282 0.29
283 0.28
284 0.27
285 0.23
286 0.22
287 0.24
288 0.22
289 0.19
290 0.17
291 0.18
292 0.18
293 0.2
294 0.24
295 0.22
296 0.22
297 0.21
298 0.21
299 0.2
300 0.19
301 0.18
302 0.16
303 0.18
304 0.19
305 0.19
306 0.17
307 0.16
308 0.16
309 0.15
310 0.13
311 0.12
312 0.1
313 0.1
314 0.11
315 0.13
316 0.14
317 0.14
318 0.14
319 0.13
320 0.15
321 0.16
322 0.18
323 0.2
324 0.19
325 0.21
326 0.23
327 0.3
328 0.32
329 0.37
330 0.38
331 0.42
332 0.51
333 0.58
334 0.67
335 0.67
336 0.74
337 0.78
338 0.85
339 0.85
340 0.85
341 0.86
342 0.85
343 0.85
344 0.81