Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R5Y8

Protein Details
Accession G2R5Y8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
154-177RVEVSRGRSLPKKKKANRSAGAEEHydrophilic
NLS Segment(s)
PositionSequence
160-171GRSLPKKKKANR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
KEGG ttt:THITE_2089888  -  
Amino Acid Sequences MAPTTDVPSPNGATKSSGGDMDSPMRGYSDSPLEQHRQDLQRAIERSIRTLFSTGLTPDAVSTILRKTFYTSAKLEGHKTREIRDNIREGGVASAAAAAEEGPSASFGPGPLLEEGYGQGCPVREQMVGFGAQLDRISARVDEITSMVKSATYRVEVSRGRSLPKKKKANRSAGAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.24
4 0.23
5 0.19
6 0.19
7 0.21
8 0.21
9 0.21
10 0.18
11 0.16
12 0.16
13 0.15
14 0.15
15 0.15
16 0.18
17 0.18
18 0.19
19 0.24
20 0.28
21 0.28
22 0.31
23 0.35
24 0.33
25 0.33
26 0.36
27 0.35
28 0.39
29 0.4
30 0.39
31 0.37
32 0.34
33 0.35
34 0.32
35 0.3
36 0.23
37 0.23
38 0.2
39 0.16
40 0.17
41 0.14
42 0.13
43 0.12
44 0.1
45 0.09
46 0.09
47 0.08
48 0.07
49 0.07
50 0.08
51 0.1
52 0.11
53 0.11
54 0.14
55 0.19
56 0.21
57 0.25
58 0.23
59 0.27
60 0.31
61 0.32
62 0.33
63 0.33
64 0.35
65 0.35
66 0.35
67 0.33
68 0.37
69 0.38
70 0.39
71 0.38
72 0.37
73 0.33
74 0.32
75 0.29
76 0.21
77 0.18
78 0.13
79 0.09
80 0.05
81 0.04
82 0.04
83 0.03
84 0.03
85 0.02
86 0.02
87 0.02
88 0.03
89 0.02
90 0.03
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.08
103 0.08
104 0.07
105 0.06
106 0.07
107 0.06
108 0.07
109 0.08
110 0.09
111 0.09
112 0.09
113 0.1
114 0.11
115 0.11
116 0.1
117 0.1
118 0.09
119 0.09
120 0.09
121 0.08
122 0.07
123 0.07
124 0.09
125 0.07
126 0.08
127 0.09
128 0.09
129 0.09
130 0.1
131 0.12
132 0.11
133 0.12
134 0.1
135 0.11
136 0.11
137 0.12
138 0.14
139 0.14
140 0.16
141 0.17
142 0.25
143 0.27
144 0.33
145 0.4
146 0.39
147 0.42
148 0.49
149 0.58
150 0.61
151 0.69
152 0.74
153 0.75
154 0.84
155 0.88
156 0.9
157 0.88