Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2QZ09

Protein Details
Accession G2QZ09    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-25IQNQRPGKSRRVIKKDEKEQKATHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
KEGG ttt:THITE_2044228  -  
Amino Acid Sequences MEIQNQRPGKSRRVIKKDEKEQKATYNTRDSLVVTDPTTNLALASLSMGERTGSRVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.82
4 0.85
5 0.86
6 0.83
7 0.79
8 0.72
9 0.7
10 0.67
11 0.6
12 0.54
13 0.49
14 0.44
15 0.38
16 0.36
17 0.29
18 0.23
19 0.21
20 0.18
21 0.13
22 0.13
23 0.12
24 0.13
25 0.13
26 0.11
27 0.09
28 0.07
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.07