Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2RFX4

Protein Details
Accession G2RFX4   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
141-165IGFVLVLRHRRKKRQQQLRDGAYANHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 5, extr 4, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ttt:THITE_2124514  -  
Amino Acid Sequences MSQASADASRQAVQASSSAEQAISNAIRSASQSASSALSASMASLTSSMGASFSSALVLASQSAAAAMRSAASVAQKAQADATALRVCHQCFSMPSKVHRLTRFQDQANSQIQQQGAALSVTQTALAVVGGIIGSSLLTGIGFVLVLRHRRKKRQQQLRDGAYANIGYPRLRGTSNKAYSVASNWKDDGSSTYSTDEKGPNFPAGSDDNNNNNNNPNDGDVIKQPAAAAVAGGSDNTTTTIVTIPRKTVGPGVGYAVSYYGPPRANNSAARSQLAATAAPAAAAPFQLGNPPPPRFAAGGSGAGKFSLFPRAKAGTTGFSRSTSPPGNRTASAGAKGGEESESESATTPTPAAQTQTQTQTQTQTTQTPNNNRLSSSASGSGMGRLHALVQGRDSDSASRDTRDRDRAGGMIGGARQPPAEGATPTPTPTQPTLDRWMRDGTTVSPFATLRAPGARRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.17
4 0.16
5 0.16
6 0.16
7 0.15
8 0.14
9 0.17
10 0.14
11 0.14
12 0.14
13 0.14
14 0.14
15 0.16
16 0.19
17 0.15
18 0.16
19 0.16
20 0.16
21 0.18
22 0.17
23 0.16
24 0.12
25 0.12
26 0.1
27 0.09
28 0.08
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.07
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.07
59 0.08
60 0.1
61 0.11
62 0.15
63 0.15
64 0.16
65 0.16
66 0.15
67 0.16
68 0.14
69 0.18
70 0.17
71 0.16
72 0.19
73 0.22
74 0.22
75 0.21
76 0.22
77 0.19
78 0.2
79 0.26
80 0.31
81 0.33
82 0.36
83 0.44
84 0.5
85 0.55
86 0.56
87 0.57
88 0.52
89 0.58
90 0.61
91 0.54
92 0.53
93 0.49
94 0.51
95 0.49
96 0.46
97 0.36
98 0.33
99 0.3
100 0.24
101 0.22
102 0.16
103 0.12
104 0.1
105 0.09
106 0.06
107 0.07
108 0.06
109 0.06
110 0.05
111 0.05
112 0.05
113 0.04
114 0.04
115 0.03
116 0.03
117 0.03
118 0.03
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.05
132 0.08
133 0.15
134 0.22
135 0.31
136 0.38
137 0.49
138 0.6
139 0.69
140 0.77
141 0.82
142 0.86
143 0.88
144 0.91
145 0.86
146 0.8
147 0.7
148 0.59
149 0.49
150 0.39
151 0.28
152 0.2
153 0.15
154 0.1
155 0.1
156 0.1
157 0.11
158 0.12
159 0.13
160 0.19
161 0.29
162 0.32
163 0.33
164 0.33
165 0.32
166 0.31
167 0.33
168 0.34
169 0.26
170 0.24
171 0.23
172 0.22
173 0.21
174 0.21
175 0.2
176 0.15
177 0.15
178 0.14
179 0.15
180 0.16
181 0.16
182 0.19
183 0.19
184 0.16
185 0.17
186 0.17
187 0.17
188 0.17
189 0.16
190 0.16
191 0.15
192 0.17
193 0.16
194 0.18
195 0.21
196 0.26
197 0.26
198 0.24
199 0.26
200 0.24
201 0.23
202 0.21
203 0.17
204 0.14
205 0.13
206 0.14
207 0.11
208 0.14
209 0.13
210 0.13
211 0.11
212 0.1
213 0.1
214 0.08
215 0.07
216 0.03
217 0.04
218 0.04
219 0.04
220 0.03
221 0.03
222 0.03
223 0.04
224 0.04
225 0.04
226 0.04
227 0.06
228 0.09
229 0.12
230 0.13
231 0.13
232 0.14
233 0.15
234 0.15
235 0.16
236 0.15
237 0.13
238 0.13
239 0.13
240 0.13
241 0.12
242 0.11
243 0.09
244 0.08
245 0.07
246 0.07
247 0.09
248 0.1
249 0.1
250 0.14
251 0.17
252 0.2
253 0.23
254 0.27
255 0.29
256 0.29
257 0.29
258 0.26
259 0.23
260 0.22
261 0.19
262 0.15
263 0.09
264 0.09
265 0.08
266 0.08
267 0.07
268 0.05
269 0.05
270 0.05
271 0.05
272 0.04
273 0.04
274 0.07
275 0.08
276 0.13
277 0.18
278 0.2
279 0.21
280 0.21
281 0.23
282 0.21
283 0.22
284 0.2
285 0.17
286 0.2
287 0.2
288 0.2
289 0.18
290 0.17
291 0.16
292 0.13
293 0.12
294 0.17
295 0.16
296 0.16
297 0.21
298 0.24
299 0.24
300 0.26
301 0.27
302 0.23
303 0.25
304 0.28
305 0.25
306 0.23
307 0.26
308 0.25
309 0.28
310 0.29
311 0.3
312 0.3
313 0.34
314 0.36
315 0.34
316 0.35
317 0.34
318 0.3
319 0.29
320 0.27
321 0.21
322 0.18
323 0.18
324 0.16
325 0.12
326 0.1
327 0.1
328 0.1
329 0.1
330 0.1
331 0.1
332 0.1
333 0.11
334 0.11
335 0.08
336 0.08
337 0.1
338 0.1
339 0.13
340 0.15
341 0.17
342 0.22
343 0.27
344 0.29
345 0.3
346 0.31
347 0.33
348 0.32
349 0.33
350 0.3
351 0.32
352 0.33
353 0.38
354 0.44
355 0.48
356 0.53
357 0.57
358 0.56
359 0.5
360 0.47
361 0.45
362 0.39
363 0.34
364 0.3
365 0.23
366 0.23
367 0.23
368 0.24
369 0.19
370 0.17
371 0.14
372 0.11
373 0.11
374 0.13
375 0.15
376 0.12
377 0.13
378 0.16
379 0.17
380 0.18
381 0.19
382 0.19
383 0.19
384 0.24
385 0.24
386 0.24
387 0.25
388 0.3
389 0.37
390 0.43
391 0.43
392 0.41
393 0.41
394 0.39
395 0.38
396 0.33
397 0.26
398 0.21
399 0.2
400 0.19
401 0.18
402 0.17
403 0.15
404 0.14
405 0.14
406 0.14
407 0.15
408 0.14
409 0.17
410 0.21
411 0.23
412 0.25
413 0.27
414 0.25
415 0.27
416 0.28
417 0.32
418 0.32
419 0.36
420 0.43
421 0.48
422 0.48
423 0.46
424 0.5
425 0.44
426 0.41
427 0.38
428 0.32
429 0.32
430 0.32
431 0.29
432 0.27
433 0.26
434 0.25
435 0.26
436 0.23
437 0.19
438 0.26