Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0U5V4

Protein Details
Accession Q0U5V4    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
144-167EEGGGKKKKAASRKKKKTDDDDDFBasic
NLS Segment(s)
PositionSequence
147-160GGKKKKAASRKKKK
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0017054  C:negative cofactor 2 complex  
GO:0005634  C:nucleus  
GO:0001046  F:core promoter sequence-specific DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0016251  F:RNA polymerase II general transcription initiation factor activity  
GO:0006366  P:transcription by RNA polymerase II  
KEGG pno:SNOG_12860  -  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MPRGVPKEESMQDADYMPDESVALGKLSETGNGTSSGGSTLPPNVNDIVIKNHFPVARIKRIMQADDDVGKVAQVTPVVVSKALELFMISLVTKAAAEAKSRNSKRVNTLHLKQAVVNNEQFDFLNEIVSKVADAPEKSEDAMEEGGGKKKKAASRKKKKTDDDDDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.19
3 0.18
4 0.14
5 0.11
6 0.09
7 0.08
8 0.08
9 0.08
10 0.07
11 0.06
12 0.06
13 0.08
14 0.08
15 0.1
16 0.11
17 0.11
18 0.12
19 0.13
20 0.13
21 0.11
22 0.11
23 0.1
24 0.09
25 0.08
26 0.08
27 0.11
28 0.13
29 0.13
30 0.15
31 0.14
32 0.15
33 0.15
34 0.15
35 0.17
36 0.17
37 0.18
38 0.17
39 0.2
40 0.2
41 0.21
42 0.28
43 0.28
44 0.34
45 0.36
46 0.36
47 0.39
48 0.4
49 0.4
50 0.33
51 0.29
52 0.23
53 0.21
54 0.2
55 0.14
56 0.12
57 0.11
58 0.09
59 0.07
60 0.06
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.05
72 0.04
73 0.04
74 0.04
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.06
83 0.07
84 0.09
85 0.11
86 0.17
87 0.27
88 0.28
89 0.35
90 0.36
91 0.39
92 0.45
93 0.5
94 0.52
95 0.51
96 0.53
97 0.54
98 0.54
99 0.51
100 0.45
101 0.42
102 0.38
103 0.33
104 0.31
105 0.25
106 0.22
107 0.22
108 0.2
109 0.17
110 0.16
111 0.13
112 0.14
113 0.13
114 0.13
115 0.12
116 0.12
117 0.11
118 0.08
119 0.11
120 0.11
121 0.12
122 0.14
123 0.17
124 0.17
125 0.18
126 0.17
127 0.15
128 0.15
129 0.15
130 0.12
131 0.12
132 0.13
133 0.2
134 0.23
135 0.23
136 0.23
137 0.29
138 0.36
139 0.44
140 0.53
141 0.57
142 0.66
143 0.77
144 0.85
145 0.89
146 0.93
147 0.93