Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4QYL3

Protein Details
Accession C4QYL3   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-40GGLLWKRPWRMSKPQKYRLRKRMQLVDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, mito_nucl 13.5, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG ppa:PAS_chr1-4_0484  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRATLVDLGGLLWKRPWRMSKPQKYRLRKRMQLVDSNIDIIYQGLTEEGLSCKVIDNLKQNFPKEHEVLPKNKYTVFNKTAKNYRKGVHLVPKWTKKSLRENPEFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.15
4 0.17
5 0.19
6 0.25
7 0.32
8 0.35
9 0.46
10 0.57
11 0.65
12 0.72
13 0.8
14 0.85
15 0.88
16 0.92
17 0.92
18 0.91
19 0.87
20 0.85
21 0.84
22 0.79
23 0.77
24 0.7
25 0.64
26 0.54
27 0.47
28 0.39
29 0.29
30 0.23
31 0.15
32 0.1
33 0.05
34 0.04
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.05
44 0.08
45 0.09
46 0.11
47 0.18
48 0.21
49 0.29
50 0.33
51 0.34
52 0.34
53 0.37
54 0.39
55 0.34
56 0.35
57 0.37
58 0.38
59 0.42
60 0.43
61 0.43
62 0.39
63 0.4
64 0.42
65 0.37
66 0.41
67 0.42
68 0.46
69 0.47
70 0.53
71 0.59
72 0.61
73 0.63
74 0.59
75 0.55
76 0.55
77 0.55
78 0.55
79 0.56
80 0.54
81 0.58
82 0.63
83 0.7
84 0.68
85 0.71
86 0.69
87 0.67
88 0.72
89 0.73
90 0.74