FuNGI

G2R4T4

Protein Details

Accession

G2R4T4

Localization Confidence

Medium

Confidence Score

10.5

NoLS Segment(s)

Position	Sequence	Protein Nature
327-350	QLDARERARRRSRSRSRENHADTF	Hydrophilic

NLS Segment(s)

Position	Sequence
333-341	RARRRSRSR

Subcellular Location(s)

mito 10, nucl 8.5, cyto_nucl 7, cyto 4.5, plas 2, extr 2

Family & Domain DBs

InterPro	View protein in InterPro IPR018108 Mitochondrial_sb/sol_carrier IPR023395 Mt_carrier_dom_sf IPR045315 Mtm1-like
Gene Ontology	GO:0005743 C:mitochondrial inner membrane GO:1990542 P:mitochondrial transmembrane transport
KEGG	ttt:THITE_2154403 -
Pfam	View protein in Pfam PF00153 Mito_carr
PROSITE	View protein in PROSITE PS50920 SOLCAR

Amino Acid Sequences

MASLAKSSQAPDAGQNHDRIASRGPPSDPDDPAGDPVEITAVQKMLSATSGSLLTGLLATPLDVVRVRWQSQSISQPGPVDFLKLAMPATSSPGAAAFRPATLGVTACCREVFFASNTSEICFIGPRPLNPSFAPTNSSSSGTSQITCAVEQTQQRTFTSTFDGLRKIARNEGVTTLWRGLSPTLIMAIPANIIYFTGYEWLRFNHSSPIARTVRDEYAPPVAGSAARMLAATAVSPIELFRTRLQALQGASSSRGGHLADTFAGIRDMVAAHGYRSLWRGLTLTLWRDVPFSGMYWWGYETIRGRLTDARERARGRGGASLELDLQLDARERARRRSRSRSRENHADTFADSFIAGAASGAFASVATMPFDVGKTRTQVFRDANKAASAASAASAAAATPAADAASAAVAPEERNMARLLWHIFRTEGVPGLFRGWIPRTLRVAPACAIMISSYEVGKRVFRGVNERALAERRASAEAAAAARGWFCLL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.37
2	0.38
3	0.36
4	0.38
5	0.37
6	0.33
7	0.32
8	0.33
9	0.34
10	0.36
11	0.37
12	0.37
13	0.43
14	0.46
15	0.43
16	0.38
17	0.36
18	0.32
19	0.33
20	0.3
21	0.24
22	0.18
23	0.16
24	0.15
25	0.13
26	0.12
27	0.11
28	0.1
29	0.1
30	0.12
31	0.12
32	0.1
33	0.11
34	0.11
35	0.09
36	0.1
37	0.11
38	0.09
39	0.09
40	0.08
41	0.07
42	0.07
43	0.06
44	0.05
45	0.05
46	0.05
47	0.06
48	0.06
49	0.08
50	0.08
51	0.1
52	0.17
53	0.23
54	0.25
55	0.26
56	0.29
57	0.3
58	0.35
59	0.42
60	0.4
61	0.37
62	0.37
63	0.37
64	0.35
65	0.35
66	0.29
67	0.24
68	0.18
69	0.17
70	0.15
71	0.13
72	0.13
73	0.1
74	0.11
75	0.09
76	0.14
77	0.13
78	0.12
79	0.12
80	0.13
81	0.14
82	0.13
83	0.16
84	0.12
85	0.11
86	0.12
87	0.13
88	0.12
89	0.11
90	0.12
91	0.09
92	0.13
93	0.14
94	0.14
95	0.14
96	0.13
97	0.14
98	0.15
99	0.17
100	0.14
101	0.17
102	0.18
103	0.19
104	0.19
105	0.19
106	0.18
107	0.15
108	0.14
109	0.11
110	0.1
111	0.16
112	0.18
113	0.18
114	0.24
115	0.25
116	0.28
117	0.27
118	0.32
119	0.27
120	0.26
121	0.29
122	0.24
123	0.27
124	0.25
125	0.27
126	0.23
127	0.21
128	0.25
129	0.22
130	0.2
131	0.16
132	0.18
133	0.17
134	0.16
135	0.15
136	0.13
137	0.16
138	0.18
139	0.22
140	0.23
141	0.24
142	0.24
143	0.27
144	0.26
145	0.24
146	0.26
147	0.25
148	0.23
149	0.23
150	0.25
151	0.22
152	0.25
153	0.28
154	0.24
155	0.25
156	0.26
157	0.25
158	0.25
159	0.26
160	0.24
161	0.22
162	0.22
163	0.19
164	0.16
165	0.14
166	0.13
167	0.11
168	0.1
169	0.09
170	0.07
171	0.07
172	0.07
173	0.07
174	0.06
175	0.06
176	0.05
177	0.05
178	0.05
179	0.04
180	0.04
181	0.04
182	0.04
183	0.04
184	0.07
185	0.07
186	0.08
187	0.09
188	0.1
189	0.14
190	0.14
191	0.16
192	0.18
193	0.21
194	0.23
195	0.23
196	0.31
197	0.28
198	0.28
199	0.29
200	0.27
201	0.26
202	0.24
203	0.24
204	0.17
205	0.19
206	0.19
207	0.17
208	0.13
209	0.11
210	0.1
211	0.1
212	0.09
213	0.05
214	0.05
215	0.05
216	0.05
217	0.05
218	0.04
219	0.04
220	0.04
221	0.03
222	0.03
223	0.03
224	0.03
225	0.05
226	0.06
227	0.08
228	0.09
229	0.12
230	0.13
231	0.14
232	0.15
233	0.16
234	0.16
235	0.15
236	0.15
237	0.12
238	0.12
239	0.12
240	0.12
241	0.09
242	0.1
243	0.08
244	0.08
245	0.08
246	0.08
247	0.06
248	0.07
249	0.07
250	0.06
251	0.06
252	0.05
253	0.05
254	0.04
255	0.04
256	0.04
257	0.05
258	0.05
259	0.05
260	0.06
261	0.07
262	0.07
263	0.09
264	0.09
265	0.09
266	0.09
267	0.1
268	0.09
269	0.12
270	0.13
271	0.14
272	0.14
273	0.15
274	0.15
275	0.15
276	0.14
277	0.13
278	0.11
279	0.1
280	0.09
281	0.09
282	0.09
283	0.09
284	0.1
285	0.1
286	0.09
287	0.11
288	0.13
289	0.15
290	0.17
291	0.17
292	0.18
293	0.2
294	0.25
295	0.3
296	0.33
297	0.34
298	0.38
299	0.4
300	0.4
301	0.4
302	0.38
303	0.31
304	0.31
305	0.27
306	0.24
307	0.23
308	0.22
309	0.18
310	0.16
311	0.15
312	0.1
313	0.09
314	0.07
315	0.07
316	0.07
317	0.1
318	0.16
319	0.18
320	0.29
321	0.38
322	0.48
323	0.55
324	0.66
325	0.74
326	0.78
327	0.87
328	0.87
329	0.85
330	0.86
331	0.85
332	0.79
333	0.7
334	0.61
335	0.5
336	0.43
337	0.34
338	0.23
339	0.16
340	0.1
341	0.08
342	0.07
343	0.06
344	0.04
345	0.03
346	0.03
347	0.03
348	0.03
349	0.03
350	0.03
351	0.03
352	0.04
353	0.05
354	0.05
355	0.06
356	0.06
357	0.07
358	0.08
359	0.09
360	0.1
361	0.12
362	0.15
363	0.18
364	0.22
365	0.23
366	0.31
367	0.35
368	0.4
369	0.44
370	0.44
371	0.43
372	0.39
373	0.37
374	0.29
375	0.24
376	0.17
377	0.1
378	0.08
379	0.07
380	0.06
381	0.05
382	0.05
383	0.05
384	0.04
385	0.04
386	0.04
387	0.03
388	0.04
389	0.04
390	0.04
391	0.04
392	0.04
393	0.04
394	0.04
395	0.04
396	0.04
397	0.05
398	0.05
399	0.06
400	0.1
401	0.09
402	0.11
403	0.12
404	0.12
405	0.13
406	0.17
407	0.21
408	0.22
409	0.24
410	0.24
411	0.23
412	0.24
413	0.24
414	0.21
415	0.2
416	0.16
417	0.16
418	0.16
419	0.17
420	0.17
421	0.16
422	0.2
423	0.19
424	0.25
425	0.27
426	0.33
427	0.37
428	0.39
429	0.45
430	0.42
431	0.43
432	0.37
433	0.36
434	0.29
435	0.24
436	0.21
437	0.15
438	0.14
439	0.12
440	0.12
441	0.11
442	0.11
443	0.14
444	0.15
445	0.17
446	0.18
447	0.22
448	0.25
449	0.27
450	0.35
451	0.38
452	0.45
453	0.45
454	0.44
455	0.42
456	0.43
457	0.41
458	0.35
459	0.33
460	0.27
461	0.28
462	0.27
463	0.23
464	0.21
465	0.22
466	0.21
467	0.18
468	0.16
469	0.13
470	0.13

G2R4T4

3D AlphaFold-predicted Structure Viewer